StarFunc result for job id P00846

User Input

>input (226 residues)
MNENLFASFIAPTILGLPAAVLIILFPPLLIPTSKYLINNRLITTQQWLIKLTSKQMMTM
HNTKGRTWSLMLVSLIIFIATTNLLGLLPHSFTPTTQLSMNLAMAIPLWAGTVIMGFRSK
IKNALAHFLPQGTPTPLIPMLVIIETISLLIQPMALAVRLTANITAGHLLMHLIGSATLA
MSTINLPSTLIIFTILILLTILEIAVALIQAYVFTLLVSLYLHDNT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P00846	1.000	1.000	1.246E-28	226	1.000	1.000	P00846.pdb.gz	ATP6_HUMAN ATP synthase subunit a OS=Homo sapiens OX=9606 GN=MT-ATP6 PE=1 SV=1
2	AFDB:P00847	0.993	0.993	2.351E-24	226	0.779	0.779	P00847.pdb.gz	ATP6_BOVIN ATP synthase subunit a OS=Bos taurus OX=9913 GN=MT-ATP6 PE=1 SV=1
3	AFDB:P00848	0.994	0.994	2.023E-23	226	0.757	0.757	P00848.pdb.gz	ATP6_MOUSE ATP synthase subunit a OS=Mus musculus OX=10090 GN=Mtatp6 PE=1 SV=1
4	PDB:6zpoa	0.980	0.980	1.049E-21	226	0.779	0.779	6zpoa.pdb.gz	Structure of the dimeric ATP synthase from bovine mitochondria.
5	AFDB:P00850	0.940	0.948	8.540E-14	224	0.350	0.353	P00850.pdb.gz	ATP6_DROME ATP synthase subunit a OS=Drosophila melanogaster OX=7227 GN=mt:ATPase6 PE=3 SV=4
6	AFDB:P00854	0.849	0.749	4.529E-11	259	0.288	0.251	P00854.pdb.gz	ATP6_YEAST ATP synthase subunit a OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATP6 PE=1 SV=2
7	AFDB:B2KIT2	0.863	0.797	7.495E-11	246	0.301	0.276	B2KIT2.pdb.gz	B2KIT2_CANPA ATP synthase subunit a OS=Candida parapsilosis OX=5480 GN=ATP6 PE=3 SV=1
8	AFDB:P00852	0.817	0.726	1.633E-10	256	0.288	0.254	P00852.pdb.gz	ATP6_EMEND ATP synthase subunit a OS=Emericella nidulans OX=162425 GN=atp6 PE=3 SV=1
9	AFDB:A0PJ36	0.811	0.558	4.680E-10	337	0.261	0.175	A0PJ36.pdb.gz	A0PJ36_ORYSI ATP synthase subunit a OS=Oryza sativa subsp. indica OX=39946 GN=atp6 PE=2 SV=1
10	PDB:6b2za	0.869	0.794	5.676E-10	249	0.292	0.265	6b2za.pdb.gz	Atomic model for the dimeric FO region of mitochondrial ATP synthase.
11	PDB:6oqra	0.693	0.599	4.286E-6	266	0.199	0.169	6oqra.pdb.gz	Cryo-EM structures provide insight into how E. coli F1FoATP synthase accommodates symmetry mismatch.
12	AFDB:A0A0F6B941	0.558	0.480	8.327E-5	271	0.204	0.170	A0A0F6B941.pdb.gz	A0A0F6B941_SALT1 ATP synthase subunit a OS=Salmonella typhimurium (strain 14028s / SGSC 2262) OX=588858 GN=atpB PE=1 SV=1
13	AFDB:P56758	0.486	0.448	2.150E-3	249	0.181	0.165	P56758.pdb.gz	ATPI_ARATH ATP synthase subunit a, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=atpI PE=3 SV=1
14	PDB:7f02B	0.142	0.145	1.152	220	0.111	0.114	7f02B.pdb.gz	Structures of the CcmABCD heme release complex at multiple states.
15	PDB:5tj5B	0.229	0.270	1.739	187	0.133	0.160	5tj5B.pdb.gz
16	PDB:7uw9i	0.257	0.350	1.739	156	0.080	0.115	7uw9i.pdb.gz
17	PDB:7khro	0.248	0.354	2.508	151	0.062	0.093	7khro.pdb.gz	Molecular basis of V-ATPase inhibition by bafilomycin A1.
18	PDB:7o3vF	0.336	0.301	2.508	261	0.146	0.126	7o3vF.pdb.gz
19	PDB:7taoD	0.165	0.216	2.626	158	0.115	0.165	7taoD.pdb.gz	Cryo-EM of the Yeast V O Complex Reveals Distinct Binding Sites for Macrolide V-ATPase Inhibitors.
20	PDB:5mkkB	0.171	0.091	2.878	577	0.119	0.047	5mkkB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P00846	3.08e-156	434	226	1.000	1.000	ATP6_HUMAN ATP synthase subunit a OS=Homo sapiens OX=9606 GN=MT-ATP6 PE=1 SV=1
2	P00847	5.51e-123	349	226	0.779	0.779	ATP6_BOVIN ATP synthase subunit a OS=Bos taurus OX=9913 GN=MT-ATP6 PE=1 SV=1
3	P05504	8.85e-118	336	226	0.757	0.757	ATP6_RAT ATP synthase subunit a OS=Rattus norvegicus OX=10116 GN=Mt-atp6 PE=1 SV=3
4	P00848	8.70e-111	318	226	0.757	0.757	ATP6_MOUSE ATP synthase subunit a OS=Mus musculus OX=10090 GN=Mtatp6 PE=1 SV=1
5	P00850	6.32e-33	120	224	0.376	0.379	ATP6_DROME ATP synthase subunit a OS=Drosophila melanogaster OX=7227 GN=mt:ATPase6 PE=3 SV=4
6	P00854	5.54e-31	116	259	0.327	0.286	ATP6_YEAST ATP synthase subunit a OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATP6 PE=1 SV=2
7	B2KIT2	9.13e-26	102	246	0.310	0.285	B2KIT2_CANPA ATP synthase subunit a OS=Candida parapsilosis OX=5480 GN=ATP6 PE=3 SV=1
8	A0PJ36	7.13e-24	99.4	337	0.274	0.184	A0PJ36_ORYSI ATP synthase subunit a OS=Oryza sativa subsp. indica OX=39946 GN=atp6 PE=2 SV=1
9	P00852	3.94e-18	82.4	256	0.279	0.246	ATP6_EMEND ATP synthase subunit a OS=Emericella nidulans OX=162425 GN=atp6 PE=3 SV=1
10	O21786	1.69e-16	79.0	337	0.292	0.196	O21786_ORYSA ATP synthase subunit a OS=Oryza sativa OX=4530 GN=atp6 PE=3 SV=1
11	Q2F976	1.75e-16	79.0	337	0.292	0.196	Q2F976_ORYSI ATP synthase subunit a OS=Oryza sativa subsp. indica OX=39946 GN=atp6 PE=3 SV=1
12	Q37807	1.75e-16	79.0	337	0.292	0.196	Q37807_ORYSA ATP synthase subunit a OS=Oryza sativa OX=4530 GN=atp6 PE=3 SV=1
13	Q36986	1.80e-16	79.0	336	0.292	0.196	Q36986_ORYSA ATP synthase subunit a OS=Oryza sativa OX=4530 GN=atp6 PE=3 SV=1
14	A0A0F6B941	3.17e-04	43.1	271	0.208	0.173	A0A0F6B941_SALT1 ATP synthase subunit a OS=Salmonella typhimurium (strain 14028s / SGSC 2262) OX=588858 GN=atpB PE=1 SV=1
15	P0AB98	3.17e-04	43.1	271	0.208	0.173	ATP6_ECOLI ATP synthase subunit a OS=Escherichia coli (strain K12) OX=83333 GN=atpB PE=1 SV=1
16	Q8TAD4	0.79	33.1	765	0.159	0.047	ZNT5_HUMAN Proton-coupled zinc antiporter SLC30A5 OS=Homo sapiens OX=9606 GN=SLC30A5 PE=1 SV=1
17	P9WPV7	1.8	31.6	250	0.190	0.172	ATP6_MYCTU ATP synthase subunit a OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=atpB PE=1 SV=1
18	Q8VZZ4	5.5	30.8	1466	0.173	0.027	AB6C_ARATH ABC transporter C family member 6 OS=Arabidopsis thaliana OX=3702 GN=ABCC6 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00119 ATP-synt_A	2.8e-38	143.5	ATP synthase A chain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354632

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000215375	0.999	ATP synthase subunit delta, mitochondrial
2	9606.ENSP00000262030	0.999	ATP synthase subunit beta, mitochondrial
3	9606.ENSP00000354687	0.999	NADH-ubiquinone oxidoreductase chain 1
4	9606.ENSP00000354961	0.999	NADH-ubiquinone oxidoreductase chain 4
5	9606.ENSP00000355265	0.999	ATP synthase protein 8
6	9606.ENSP00000381736	0.999	ATP synthase subunit alpha, mitochondrial
7	9606.ENSP00000354554	0.998	Cytochrome b
8	9606.ENSP00000354876	0.998	Cytochrome c oxidase subunit 2
9	9606.ENSP00000354982	0.998	Cytochrome c oxidase subunit 3
10	9606.ENSP00000358737	0.998	ATP synthase F(0) complex subunit B1, mitochondrial
11	9606.ENSP00000301587	0.997	ATP synthase subunit d, mitochondrial
12	9606.ENSP00000349142	0.997	ATP synthase subunit gamma, mitochondrial
13	9606.ENSP00000290299	0.996	ATP synthase subunit O, mitochondrial
14	9606.ENSP00000354499	0.996	Cytochrome c oxidase subunit 1
15	9606.ENSP00000355046	0.996	NADH-ubiquinone oxidoreductase chain 2
16	9606.ENSP00000355206	0.995	NADH-ubiquinone oxidoreductase chain 3
17	9606.ENSP00000354728	0.993	NADH-ubiquinone oxidoreductase chain 4L
18	9606.ENSP00000243997	0.991	ATP synthase subunit epsilon, mitochondrial
19	9606.ENSP00000306003	0.991	ATP synthase subunit e, mitochondrial
20	9606.ENSP00000354813	0.991	NADH-ubiquinone oxidoreductase chain 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0046933	0.999	proton-transporting ATP synthase activity, rotational mechanism

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.984	cellular metabolic process
GO:0071704	0.983	organic substance metabolic process
GO:0044238	0.980	primary metabolic process
GO:0009060	0.967	aerobic respiration
GO:1901566	0.966	organonitrogen compound biosynthetic process
GO:0034641	0.946	cellular nitrogen compound metabolic process
GO:0044271	0.944	cellular nitrogen compound biosynthetic process
GO:0046483	0.935	heterocycle metabolic process
GO:0006725	0.935	cellular aromatic compound metabolic process
GO:0006119	0.934	oxidative phosphorylation
GO:0015986	0.927	proton motive force-driven ATP synthesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1902494	0.999	catalytic complex
GO:0098796	0.999	membrane protein complex
GO:0031966	0.996	mitochondrial membrane
GO:0019866	0.995	organelle inner membrane
GO:0098800	0.994	inner mitochondrial membrane protein complex
GO:0045259	0.987	proton-transporting ATP synthase complex
GO:0005753	0.874	mitochondrial proton-transporting ATP synthase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:57720	0.999	ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate
EC:7.1.2.2	0.999	H(+)-transporting two-sector ATPase.

[back to server]