StarFunc result for job id P00966

User Input

>input (412 residues)
MSSKGSVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVF
IEDVSREFVEEFIWPAIQSSALYEDRYLLGTSLARPCIARKQVEIAQREGAKYVSHGATG
KGNDQVRFELSCYSLAPQIKVIAPWRMPEFYNRFKGRNDLMEYAKQHGIPIPVTPKNPWS
MDENLMHISYEAGILENPKNQAPPGLYTKTQDPAKAPNTPDILEIEFKKGVPVKVTNVKD
GTTHQTSLELFMYLNEVAGKHGVGRIDIVENRFIGMKSRGIYETPAGTILYHAHLDIEAF
TMDREVRKIKQGLGLKFAELVYTGFWHSPECEFVRHCIAKSQERVEGKVQVSVLKGQVYI
LGRESPLSLYNEELVSMNVQGDYEPTDATGFININSLRLKEYHRLQSKVTAK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P00966	1.000	1.000	1.758E-82	412	1.000	1.000	P00966.pdb.gz	ASSY_HUMAN Argininosuccinate synthase OS=Homo sapiens OX=9606 GN=ASS1 PE=1 SV=2
2	PDB:2nz2A	0.963	0.986	3.068E-72	402	0.973	0.998	2nz2A.pdb.gz	Structure of human argininosuccinate synthetase.
3	AFDB:Q5ZJ23	0.988	0.978	1.226E-71	416	0.784	0.776	Q5ZJ23.pdb.gz	ASSY_CHICK Argininosuccinate synthase OS=Gallus gallus OX=9031 GN=ASS1 PE=2 SV=1
4	AFDB:Q6FWJ8	0.971	0.952	3.792E-57	420	0.517	0.507	Q6FWJ8.pdb.gz	Q6FWJ8_CANGA argininosuccinate synthase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=ARG1 PE=3 SV=1
5	AFDB:A0A1D8PRR5	0.980	0.970	1.083E-56	416	0.534	0.529	A0A1D8PRR5.pdb.gz	A0A1D8PRR5_CANAL argininosuccinate synthase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ARG1 PE=3 SV=1
6	AFDB:O94354	0.949	0.954	3.094E-56	410	0.522	0.524	O94354.pdb.gz	ASSY_SCHPO Argininosuccinate synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=arg12 PE=1 SV=1
7	AFDB:P22768	0.978	0.960	1.301E-55	420	0.495	0.486	P22768.pdb.gz	ASSY_YEAST Argininosuccinate synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ARG1 PE=1 SV=3
8	AFDB:Q9SZX3	0.930	0.778	4.362E-49	494	0.442	0.368	Q9SZX3.pdb.gz	ASSY_ARATH Argininosuccinate synthase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At4g24830 PE=1 SV=3
9	AFDB:P77973	0.919	0.947	2.159E-45	400	0.398	0.410	P77973.pdb.gz	ASSY_SYNY3 Argininosuccinate synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=argG PE=1 SV=1
10	AFDB:P9WPW7	0.908	0.939	1.726E-42	398	0.371	0.384	P9WPW7.pdb.gz	ASSY_MYCTU Argininosuccinate synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=argG PE=1 SV=1
11	AFDB:P0A6E4	0.901	0.834	1.742E-32	447	0.257	0.237	P0A6E4.pdb.gz	ASSY_ECOLI Argininosuccinate synthase OS=Escherichia coli (strain K12) OX=83333 GN=argG PE=1 SV=2
12	PDB:1k92A	0.892	0.830	8.143E-32	444	0.255	0.236	1k92A.pdb.gz
13	PDB:2detA	0.291	0.324	9.214E-6	365	0.114	0.129	2detA.pdb.gz	Snapshots of tRNA sulphuration via an adenylated intermediate
14	PDB:1wxiA	0.277	0.419	1.515E-5	261	0.058	0.092	1wxiA.pdb.gz	Structures of Escherichia coli NAD Synthetase with Substrates and Products Reveal Mechanistic Rearrangements
15	PDB:3uowB	0.232	0.203	2.032E-4	477	0.061	0.052	3uowB.pdb.gz	Crystal Structure of PF10_0123, a GMP Synthetase from Plasmodium Falciparum
16	PDB:3d0rB	0.204	0.218	2.678E-4	381	0.061	0.066	3d0rB.pdb.gz
17	PDB:3bg5B	0.200	0.083	3.731E-4	1074	0.090	0.034	3bg5B.pdb.gz	Crystal structures of human and Staphylococcus aureus pyruvate carboxylase and molecular insights into the carboxyltransfer reaction.
18	PDB:2vxoB	0.279	0.184	4.654E-4	658	0.078	0.049	2vxoB.pdb.gz	Substrate Specificity and Oligomerization of Human Gmp Synthetase
19	PDB:5cslB	0.195	0.053	5.804E-4	2072	0.129	0.026	5cslB.pdb.gz	Crystal structure of the 500-kDa yeast acetyl-CoA carboxylase holoenzyme dimer.
20	PDB:6gq3A	0.269	0.224	5.804E-4	509	0.080	0.065	6gq3A.pdb.gz	High-resolution crystal structure of human asparagine synthetase enables analysis of inhibitor binding and selectivity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P00966	0.0	858	412	1.000	1.000	ASSY_HUMAN Argininosuccinate synthase OS=Homo sapiens OX=9606 GN=ASS1 PE=1 SV=2
2	P09034	0.0	843	412	0.976	0.976	ASSY_RAT Argininosuccinate synthase OS=Rattus norvegicus OX=10116 GN=Ass1 PE=1 SV=1
3	P16460	0.0	838	412	0.968	0.968	ASSY_MOUSE Argininosuccinate synthase OS=Mus musculus OX=10090 GN=Ass1 PE=1 SV=1
4	Q5T6L4	0.0	858	412	1.000	1.000	Q5T6L4_HUMAN Argininosuccinate synthase OS=Homo sapiens OX=9606 GN=ASS1 PE=2 SV=1
5	Q5ZJ23	0.0	709	416	0.786	0.779	ASSY_CHICK Argininosuccinate synthase OS=Gallus gallus OX=9031 GN=ASS1 PE=2 SV=1
6	Q6FWJ8	1.38e-157	452	420	0.522	0.512	Q6FWJ8_CANGA argininosuccinate synthase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=ARG1 PE=3 SV=1
7	A0A1D8PRR5	3.20e-154	444	416	0.534	0.529	A0A1D8PRR5_CANAL argininosuccinate synthase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ARG1 PE=3 SV=1
8	O94354	2.57e-151	436	410	0.522	0.524	ASSY_SCHPO Argininosuccinate synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=arg12 PE=1 SV=1
9	P22768	3.32e-150	434	420	0.500	0.490	ASSY_YEAST Argininosuccinate synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ARG1 PE=1 SV=3
10	Q9SZX3	7.86e-123	367	494	0.442	0.368	ASSY_ARATH Argininosuccinate synthase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At4g24830 PE=1 SV=3
11	P77973	4.58e-99	303	400	0.405	0.417	ASSY_SYNY3 Argininosuccinate synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=argG PE=1 SV=1
12	P9WPW7	1.48e-88	275	398	0.379	0.392	ASSY_MYCTU Argininosuccinate synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=argG PE=1 SV=1
13	P0A6E4	8.67e-42	154	447	0.272	0.251	ASSY_ECOLI Argininosuccinate synthase OS=Escherichia coli (strain K12) OX=83333 GN=argG PE=1 SV=2
14	Q57U86	1.40e-06	53.1	1833	0.146	0.033	Q57U86_TRYB2 argininosuccinate synthase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.6E7.720 PE=3 SV=1
15	B9G5N1	1.1	33.9	844	0.044	0.021	PAIR3_ORYSJ Meiosis-specific protein PAIR3 OS=Oryza sativa subsp. japonica OX=39947 GN=PAIR3 PE=2 SV=1
16	P77756	2.0	32.7	231	0.051	0.091	QUEC_ECOLI 7-cyano-7-deazaguanine synthase OS=Escherichia coli (strain K12) OX=83333 GN=queC PE=1 SV=1
17	Q6TV08	3.1	30.4	94	0.032	0.138	Q6TV08_PAVHB 11 kDa protein OS=Human parvovirus B19 OX=10798 GN=11 kDa PE=4 SV=1
18	Q9Z179	3.2	32.7	668	0.058	0.036	SHCBP_MOUSE SHC SH2 domain-binding protein 1 OS=Mus musculus OX=10090 GN=Shcbp1 PE=1 SV=1
19	P0DJZ0	3.3	30.4	94	0.032	0.138	11K_PAVHV Host-modulation protein 11K OS=Human parvovirus B19 (strain HV) OX=648237 GN=11K PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00764 Arginosuc_synth	3.9e-172	584.5	Arginosuccinate synthase
2	PF06508 QueC	0.26	22.3	Queuosine biosynthesis protein QueC
3	PF03054 tRNA_Me_trans	17	16.6	tRNA methyl transferase HUP domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361471

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000039007	0.999	Ornithine carbamoyltransferase, mitochondrial
2	9606.ENSP00000307188	0.999	Argininosuccinate lyase
3	9606.ENSP00000402608	0.995	Carbamoyl-phosphate synthase [ammonia], mitochondrial
4	9606.ENSP00000175506	0.990	Asparagine synthetase
5	9606.ENSP00000355493	0.990	Adenylosuccinate synthetase isozyme 2
6	9606.ENSP00000293404	0.988	N-acetylglutamate synthase, mitochondrial
7	9606.ENSP00000264705	0.985	CAD protein
8	9606.ENSP00000458762	0.973	NmrA-like family domain-containing protein 1
9	9606.ENSP00000297494	0.970	Nitric oxide synthase, endothelial
10	9606.ENSP00000477999	0.959	Nitric oxide synthase, brain
11	9606.ENSP00000333019	0.958	Adenylosuccinate synthetase isozyme 1
12	9606.ENSP00000327251	0.954	Nitric oxide synthase, inducible
13	9606.ENSP00000396527	0.953	annotation not available
14	9606.ENSP00000359539	0.941	Aspartate aminotransferase, cytoplasmic
15	9606.ENSP00000245206	0.937	Aspartate aminotransferase, mitochondrial
16	9606.ENSP00000303077	0.921	Putative aspartate aminotransferase, cytoplasmic 2
17	9606.ENSP00000413064	0.915	N-acetylaspartate synthetase
18	9606.ENSP00000263080	0.907	Aspartoacylase
19	9606.ENSP00000360268	0.907	Delta-1-pyrroline-5-carboxylate synthase
20	9606.ENSP00000357838	0.906	Ornithine aminotransferase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004055	1.000	argininosuccinate synthase activity
GO:0005515	0.999	protein binding
GO:0042802	0.815	identical protein binding
GO:0097159	0.503	organic cyclic compound binding
GO:1901363	0.490	heterocyclic compound binding
GO:0043167	0.482	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.986	organic substance metabolic process
GO:0009987	0.985	cellular process
GO:0044237	0.984	cellular metabolic process
GO:0044238	0.981	primary metabolic process
GO:1901564	0.966	organonitrogen compound metabolic process
GO:0044281	0.962	small molecule metabolic process
GO:0006520	0.924	amino acid metabolic process
GO:0009058	0.909	biosynthetic process
GO:0044249	0.899	cellular biosynthetic process
GO:1901576	0.896	organic substance biosynthetic process
GO:1901605	0.892	alpha-amino acid metabolic process
GO:1901566	0.827	organonitrogen compound biosynthetic process
GO:0034641	0.697	cellular nitrogen compound metabolic process
GO:0044271	0.565	cellular nitrogen compound biosynthetic process
GO:0050896	0.530	response to stimulus
GO:0044283	0.486	small molecule biosynthetic process
GO:0009064	0.462	glutamine family amino acid metabolic process
GO:0046394	0.416	carboxylic acid biosynthetic process
GO:0008652	0.375	amino acid biosynthetic process
GO:1901607	0.353	alpha-amino acid biosynthetic process
GO:0006526	0.327	arginine biosynthetic process
GO:0048511	0.305	rhythmic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0070013	0.997	intracellular organelle lumen
GO:0005654	0.991	nucleoplasm
GO:0005829	0.978	cytosol
GO:0005739	0.966	mitochondrion
GO:0070062	0.375	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10932	1.000	ATP + L-aspartate + L-citrulline = 2-(N(omega)-L-arginino)succinate + AMP + diphosphate + H(+)
EC:6.3.4.5	1.000	argininosuccinate synthase.

[back to server]