StarFunc result for job id P00973

User Input

>input (400 residues)
MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVK
GGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFE
VQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGGYKPNPQIYVKLIEECTDL
QKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAW
ERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILD
PADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLAESNSADDETDDPR
RYQKYGYIGTHEYPHFSHRPSTLQAASTPQAEEDWTCTIL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P00973	1.000	1.000	9.238E-76	400	1.000	1.000	P00973.pdb.gz	OAS1_HUMAN 2'-5'-oligoadenylate synthase 1 OS=Homo sapiens OX=9606 GN=OAS1 PE=1 SV=4
2	AFDB:Q3ZM02	0.889	0.775	3.451E-68	459	0.882	0.769	Q3ZM02.pdb.gz	Q3ZM02_HUMAN 2'-5' oligoadenylate synthase OS=Homo sapiens OX=9606 GN=OAS1 PE=2 SV=1
3	AFDB:G3SFB1	0.881	0.852	4.298E-67	414	0.863	0.833	G3SFB1.pdb.gz	G3SFB1_GORGO 2'-5' oligoadenylate synthase OS=Gorilla gorilla gorilla OX=9595 GN=OAS1 PE=3 SV=2
4	AFDB:P11928	0.860	0.937	1.364E-53	367	0.608	0.662	P11928.pdb.gz	OAS1A_MOUSE 2'-5'-oligoadenylate synthase 1A OS=Mus musculus OX=10090 GN=Oas1a PE=1 SV=2
5	AFDB:Q05961	0.859	0.959	2.116E-53	358	0.605	0.676	Q05961.pdb.gz	OAS1A_RAT 2'-5'-oligoadenylate synthase 1A OS=Rattus norvegicus OX=10116 GN=Oas1a PE=2 SV=1
6	AFDB:Q29599	0.842	0.963	4.315E-53	349	0.650	0.745	Q29599.pdb.gz	OAS1_PIG 2'-5'-oligoadenylate synthase 1 OS=Sus scrofa OX=9823 GN=OAS1 PE=1 SV=3
7	PDB:4rwnA	0.820	0.936	6.629E-50	349	0.647	0.742	4rwnA.pdb.gz	The Activation Mechanism of 2'-5'-Oligoadenylate Synthetase Gives New Insights Into OAS/cGAS Triggers of Innate Immunity.
8	AFDB:Q9Y6K5	0.819	0.305	6.011E-44	1087	0.517	0.190	Q9Y6K5.pdb.gz	OAS3_HUMAN 2'-5'-oligoadenylate synthase 3 OS=Homo sapiens OX=9606 GN=OAS3 PE=1 SV=3
9	AFDB:Q8VI93	0.823	0.292	3.475E-43	1138	0.490	0.172	Q8VI93.pdb.gz	OAS3_MOUSE 2'-5'-oligoadenylate synthase 3 OS=Mus musculus OX=10090 GN=Oas3 PE=1 SV=1
10	AFDB:P29728	0.814	0.461	2.123E-41	719	0.460	0.256	P29728.pdb.gz	OAS2_HUMAN 2'-5'-oligoadenylate synthase 2 OS=Homo sapiens OX=9606 GN=OAS2 PE=1 SV=3
11	AFDB:Q5MYU0	0.836	0.462	2.643E-41	733	0.477	0.261	Q5MYU0.pdb.gz	OAS2_RAT 2'-5'-oligoadenylate synthase 2 OS=Rattus norvegicus OX=10116 GN=Oas2 PE=2 SV=1
12	PDB:4atbA	0.399	0.464	7.904E-9	334	0.163	0.195	4atbA.pdb.gz	NF45 Dimerizes with NF90, Zfr and Spnr Via a Conserved Domain that Has a Nucleotidyltransferase Fold.
13	PDB:5wyjCB	0.489	0.207	2.367E-7	1098	0.130	0.047	5wyjCB.pdb.gz	Molecular architecture of the 90S small subunit pre-ribosome.
14	PDB:7mq8NH	0.483	0.208	2.790E-7	1066	0.142	0.053	7mq8NH.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:4e7xD	0.431	0.523	6.709E-7	320	0.120	0.150	4e7xD.pdb.gz
16	PDB:4ud5B	0.443	0.504	7.909E-7	342	0.135	0.158	4ud5B.pdb.gz
17	PDB:3hj1B	0.424	0.435	1.161E-6	387	0.122	0.127	3hj1B.pdb.gz	Structure of the Mitochondrial Editosome-Like Complex Associated TUTase 1 Reveals Divergent Mechanisms of UTP Selection and Domain Organization.
18	PDB:3c66A	0.497	0.396	3.290E-6	529	0.125	0.095	3c66A.pdb.gz	Structure of yeast poly(A) polymerase in complex with a peptide from Fip1, an intrinsically disordered protein.
19	PDB:7lt2A	0.372	0.382	3.291E-5	387	0.122	0.127	7lt2A.pdb.gz	cGAS-like receptors sense RNA and control 3'2'-cGAMP signalling in Drosophila.
20	PDB:2q0cB	0.406	0.500	6.016E-5	311	0.107	0.138	2q0cB.pdb.gz	Dual role of the RNA substrate in selectivity and catalysis by terminal uridylyl transferases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F8VPW7	0.0	610	306	0.740	0.967	F8VPW7_HUMAN 2'-5'-oligoadenylate synthetase 1 OS=Homo sapiens OX=9606 GN=OAS1 PE=1 SV=2
2	G3SFB1	0.0	708	414	0.853	0.824	G3SFB1_GORGO 2'-5' oligoadenylate synthase OS=Gorilla gorilla gorilla OX=9595 GN=OAS1 PE=3 SV=2
3	H0YIB8	0.0	720	384	0.865	0.901	H0YIB8_HUMAN 2'-5' oligoadenylate synthase OS=Homo sapiens OX=9606 GN=OAS1 PE=1 SV=2
4	P00973	0.0	834	400	1.000	1.000	OAS1_HUMAN 2'-5'-oligoadenylate synthase 1 OS=Homo sapiens OX=9606 GN=OAS1 PE=1 SV=4
5	Q29599	0.0	539	349	0.650	0.745	OAS1_PIG 2'-5'-oligoadenylate synthase 1 OS=Sus scrofa OX=9823 GN=OAS1 PE=1 SV=3
6	Q3ZM02	0.0	719	459	0.882	0.769	Q3ZM02_HUMAN 2'-5' oligoadenylate synthase OS=Homo sapiens OX=9606 GN=OAS1 PE=2 SV=1
7	S4R3A5	0.0	719	403	0.865	0.859	S4R3A5_HUMAN 2'-5' oligoadenylate synthase OS=Homo sapiens OX=9606 GN=OAS1 PE=1 SV=2
8	P11928	1.71e-176	498	367	0.608	0.662	OAS1A_MOUSE 2'-5'-oligoadenylate synthase 1A OS=Mus musculus OX=10090 GN=Oas1a PE=1 SV=2
9	Q05961	1.34e-175	495	358	0.605	0.676	OAS1A_RAT 2'-5'-oligoadenylate synthase 1A OS=Rattus norvegicus OX=10116 GN=Oas1a PE=2 SV=1
10	Q60856	3.71e-132	385	376	0.520	0.553	OAS1B_MOUSE Inactive 2'-5'-oligoadenylate synthase 1B OS=Mus musculus OX=10090 GN=Oas1b PE=1 SV=3
11	Q91YM7	1.09e-127	379	515	0.490	0.381	Q91YM7_MOUSE 2'-5' oligoadenylate synthase (Fragment) OS=Mus musculus OX=10090 GN=Oas3 PE=2 SV=1
12	Q9Y6K5	3.86e-127	394	1087	0.517	0.190	OAS3_HUMAN 2'-5'-oligoadenylate synthase 3 OS=Homo sapiens OX=9606 GN=OAS3 PE=1 SV=3
13	Q5MYU0	1.04e-124	379	733	0.475	0.259	OAS2_RAT 2'-5'-oligoadenylate synthase 2 OS=Rattus norvegicus OX=10116 GN=Oas2 PE=2 SV=1
14	Q924S2	7.23e-123	362	362	0.460	0.508	OAS1C_MOUSE Inactive 2'-5' oligoadenylate synthetase 1C OS=Mus musculus OX=10090 GN=Oas1c PE=2 SV=1
15	P29728	3.47e-122	372	719	0.465	0.259	OAS2_HUMAN 2'-5'-oligoadenylate synthase 2 OS=Homo sapiens OX=9606 GN=OAS2 PE=1 SV=3
16	Q8VI93	5.82e-121	379	1138	0.487	0.171	OAS3_MOUSE 2'-5'-oligoadenylate synthase 3 OS=Mus musculus OX=10090 GN=Oas3 PE=1 SV=1
17	E9Q9A9	6.87e-117	358	742	0.463	0.249	OAS2_MOUSE 2'-5'-oligoadenylate synthase 2 OS=Mus musculus OX=10090 GN=Oas2 PE=1 SV=1
18	F1N3B8	6.03e-116	355	714	0.445	0.249	OAS2_BOVIN 2'-5'-oligoadenylate synthase 2 OS=Bos taurus OX=9913 GN=OAS2 PE=2 SV=1
19	Q8K3L4	7.89e-115	341	356	0.458	0.514	Q8K3L4_MOUSE 2'-5'olygoadenylate synthetase 1E, 42kD isoform OS=Mus musculus OX=10090 GN=Oas1e PE=2 SV=1
20	Q8K3L5	1.74e-114	341	386	0.458	0.474	Q8K3L5_MOUSE 2'-5'olygoadenylate synthetase 1E, 45kD isoform OS=Mus musculus OX=10090 GN=Oas1e PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01909 NTP_transf_2	7.5e-05	34.3	Nucleotidyltransferase domain
2	PF10421 OAS1_C	1.4e-86	300.5	2'-5'-oligoadenylate synthetase 1, domain 2, C-terminus
3	PF18144 SMODS	1e+02	14.5	Second Messenger Oligonucleotide or Dinucleotide Synthetase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000026796

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000001538	0.966	MX dynamin-like GTPase 1
2	9593.ENSGGOP00000014606	0.961	ISG15 ubiquitin-like modifier
3	9593.ENSGGOP00000000764	0.944	Interferon, alpha-inducible protein 6
4	9593.ENSGGOP00000007959	0.936	2'-5'-oligoadenylate synthetase 3, 100kDa
5	9593.ENSGGOP00000010453	0.932	Radical S-adenosyl methionine domain containing 2
6	9593.ENSGGOP00000011715	0.932	Interferon-induced protein with tetratricopeptide repeats 3
7	9593.ENSGGOP00000007968	0.927	2'-5'-oligoadenylate synthetase 2, 69/71kDa
8	9593.ENSGGOP00000023886	0.917	Interferon-induced protein with tetratricopeptide repeats 1
9	9593.ENSGGOP00000001535	0.904	MX dynamin-like GTPase 2
10	9593.ENSGGOP00000010150	0.904	Interferon-induced protein with tetratricopeptide repeats 2
11	9593.ENSGGOP00000008153	0.902	Interferon regulatory factor 7
12	9593.ENSGGOP00000008674	0.901	Interferon-induced protein 35
13	9593.ENSGGOP00000000601	0.896	Signal transducer and activator of transcription 1, 91kDa
14	9593.ENSGGOP00000013329	0.889	Interferon-induced protein 44
15	9593.ENSGGOP00000024885	0.889	Interferon, alpha-inducible protein 27
16	9593.ENSGGOP00000011971	0.883	XIAP associated factor 1
17	9593.ENSGGOP00000024163	0.878	DExD/H-box helicase 58
18	9593.ENSGGOP00000019722	0.875	Ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent)
19	9593.ENSGGOP00000019787	0.873	Uncharacterized protein
20	9593.ENSGGOP00000013320	0.863	Interferon-induced protein 44-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003725	1.000	double-stranded RNA binding
GO:0001730	0.998	2'-5'-oligoadenylate synthetase activity
GO:0005515	0.989	protein binding
GO:0043167	0.694	ion binding
GO:0097367	0.603	carbohydrate derivative binding
GO:0043168	0.591	anion binding
GO:0035639	0.502	purine ribonucleoside triphosphate binding
GO:0032555	0.496	purine ribonucleotide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0009615	0.992	response to virus
GO:0050789	0.986	regulation of biological process
GO:0050794	0.982	regulation of cellular process
GO:0048519	0.974	negative regulation of biological process
GO:0009987	0.959	cellular process
GO:0048525	0.957	negative regulation of viral process
GO:0006950	0.945	response to stress
GO:0098542	0.942	defense response to other organism
GO:0051607	0.921	defense response to virus
GO:0060255	0.915	regulation of macromolecule metabolic process
GO:0002376	0.895	immune system process
GO:0031323	0.885	regulation of cellular metabolic process
GO:0065009	0.882	regulation of molecular function
GO:0051171	0.879	regulation of nitrogen compound metabolic process
GO:0080090	0.878	regulation of primary metabolic process
GO:0051716	0.867	cellular response to stimulus
GO:0019219	0.866	regulation of nucleobase-containing compound metabolic process
GO:0051336	0.859	regulation of hydrolase activity
GO:0007165	0.854	signal transduction
GO:0006955	0.840	immune response
GO:0045087	0.831	innate immune response
GO:0071310	0.796	cellular response to organic substance
GO:0045069	0.778	regulation of viral genome replication
GO:0034097	0.775	response to cytokine
GO:0045071	0.751	negative regulation of viral genome replication
GO:0032069	0.717	regulation of nuclease activity
GO:0019221	0.697	cytokine-mediated signaling pathway
GO:0071357	0.639	cellular response to type I interferon
GO:0051252	0.634	regulation of RNA metabolic process
GO:0008152	0.536	metabolic process
GO:0048518	0.519	positive regulation of biological process
GO:0010468	0.476	regulation of gene expression
GO:0048583	0.457	regulation of response to stimulus
GO:0001817	0.455	regulation of cytokine production
GO:0071704	0.453	organic substance metabolic process
GO:0002682	0.442	regulation of immune system process
GO:0010604	0.430	positive regulation of macromolecule metabolic process
GO:0010628	0.415	positive regulation of gene expression
GO:0048523	0.395	negative regulation of cellular process
GO:0044237	0.384	cellular metabolic process
GO:0044238	0.362	primary metabolic process
GO:0002831	0.348	regulation of response to biotic stimulus
GO:0031347	0.337	regulation of defense response
GO:0050776	0.336	regulation of immune response
GO:0001819	0.328	positive regulation of cytokine production
GO:0032479	0.325	regulation of type I interferon production
GO:0032101	0.313	regulation of response to external stimulus
GO:0010605	0.302	negative regulation of macromolecule metabolic process
GO:0023051	0.300	regulation of signaling
GO:0010646	0.300	regulation of cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.995	intracellular membrane-bounded organelle
GO:0005634	0.972	nucleus
GO:0005829	0.961	cytosol
GO:0031981	0.961	nuclear lumen
GO:0005654	0.949	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34407	0.998	3 ATP = 5'-triphosphoadenylyl-(2'->5')-adenylyl-(2'->5')-adenosine + 2 diphosphate
EC:2.7.7.84	0.998	2'-5' oligoadenylate synthase.

[back to server]