StarFunc result for job id P01019

User Input

>input (485 residues)
MRKRAPQSEMAPAGVSLRATILCLLAWAGLAAGDRVYIHPFHLVIHNESTCEQLAKANAG
KPKDPTFIPAPIQAKTSPVDEKALQDQLVLVAAKLDTEDKLRAAMVGMLANFLGFRIYGM
HSELWGVVHGATVLSPTAVFGTLASLYLGALDHTADRLQAILGVPWKDKNCTSRLDAHKV
LSALQAVQGLLVAQGRADSQAQLLLSTVVGVFTAPGLHLKQPFVQGLALYTPVVLPRSLD
FTELDVAAEKIDRFMQAVTGWKTGCSLMGASVDSTLAFNTYVHFQGKMKGFSLLAEPQEF
WVDNSTSVSVPMLSGMGTFQHWSDIQDNFSVTQVPFTESACLLLIQPHYASDLDKVEGLT
FQQNSLNWMKKLSPRTIHLTMPQLVLQGSYDLQDLLAQAELPAILHTELNLQKLSNDRIR
VGEVLNSIFFELEADEREPTESTQQLNKPEVLEVTLNRPFLFAVYDQSATALHFLGRVAN
PLSTA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P01019	1.000	1.000	2.532E-103	485	1.000	1.000	P01019.pdb.gz	ANGT_HUMAN Angiotensinogen OS=Homo sapiens OX=9606 GN=AGT PE=1 SV=3
2	PDB:2wxwA	0.877	0.969	2.185E-77	438	0.897	0.993	2wxwA.pdb.gz
3	PDB:5m3xA	0.777	0.981	1.831E-72	383	0.779	0.987	5m3xA.pdb.gz
4	AFDB:P01017	0.903	0.920	5.580E-71	476	0.635	0.647	P01017.pdb.gz	ANGT_BOVIN Angiotensinogen OS=Bos taurus OX=9913 GN=AGT PE=1 SV=2
5	AFDB:P01015	0.912	0.927	5.562E-69	477	0.621	0.631	P01015.pdb.gz	ANGT_RAT Angiotensinogen OS=Rattus norvegicus OX=10116 GN=Agt PE=1 SV=1
6	AFDB:P11859	0.907	0.922	3.743E-67	477	0.594	0.604	P11859.pdb.gz	ANGT_MOUSE Angiotensinogen OS=Mus musculus OX=10090 GN=Agt PE=1 SV=1
7	PDB:2wxzA	0.822	0.941	4.664E-60	422	0.555	0.637	2wxzA.pdb.gz
8	PDB:2wxxB	0.848	0.958	1.211E-59	428	0.551	0.624	2wxxB.pdb.gz
9	AFDB:Q7TMF5	0.626	0.726	1.352E-27	413	0.169	0.199	Q7TMF5.pdb.gz	SPA12_MOUSE Serpin A12 OS=Mus musculus OX=10090 GN=Serpina12 PE=1 SV=2
10	AFDB:A0A024R5K8	0.666	0.766	2.003E-27	418	0.165	0.191	A0A024R5K8.pdb.gz
11	AFDB:Q8IW75	0.649	0.753	2.507E-27	414	0.173	0.203	Q8IW75.pdb.gz	SPA12_HUMAN Serpin A12 OS=Homo sapiens OX=9606 GN=SERPINA12 PE=1 SV=1
12	AFDB:Q64268	0.646	0.654	6.153E-27	479	0.161	0.163	Q64268.pdb.gz	HEP2_RAT Heparin cofactor 2 OS=Rattus norvegicus OX=10116 GN=Serpind1 PE=1 SV=1
13	AFDB:Q80ZA3	0.626	0.716	6.153E-27	418	0.184	0.213	Q80ZA3.pdb.gz	Q80ZA3_RAT Serine (Or cysteine) peptidase inhibitor, clade F, member 1 OS=Rattus norvegicus OX=10116 GN=Serpinf1 PE=2 SV=1
14	AFDB:P08185	0.650	0.766	6.509E-27	405	0.181	0.217	P08185.pdb.gz	CBG_HUMAN Corticosteroid-binding globulin OS=Homo sapiens OX=9606 GN=SERPINA6 PE=1 SV=1
15	PDB:1jmoA	0.606	0.680	1.148E-26	427	0.144	0.164	1jmoA.pdb.gz
16	PDB:3f1sA	0.618	0.762	3.948E-26	385	0.171	0.216	3f1sA.pdb.gz
17	PDB:6losA	0.623	0.799	9.161E-26	369	0.171	0.225	6losA.pdb.gz	Spatiotemporal regulation of PEDF signaling by type I collagen remodeling.
18	PDB:1imvA	0.599	0.755	1.084E-25	375	0.167	0.216	1imvA.pdb.gz
19	PDB:1hp7A	0.624	0.788	3.330E-25	376	0.167	0.215	1hp7A.pdb.gz	A 2.1 A resolution structure of an uncleaved alpha(1)-antitrypsin shows variability of the reactive center and other loops.
20	PDB:4dteA	0.613	0.772	3.726E-25	374	0.159	0.206	4dteA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P01015	0.0	605	477	0.627	0.637	ANGT_RAT Angiotensinogen OS=Rattus norvegicus OX=10116 GN=Agt PE=1 SV=1
2	P01017	0.0	624	476	0.639	0.651	ANGT_BOVIN Angiotensinogen OS=Bos taurus OX=9913 GN=AGT PE=1 SV=2
3	P01019	0.0	996	485	1.000	1.000	ANGT_HUMAN Angiotensinogen OS=Homo sapiens OX=9606 GN=AGT PE=1 SV=3
4	P11859	0.0	575	477	0.596	0.606	ANGT_MOUSE Angiotensinogen OS=Mus musculus OX=10090 GN=Agt PE=1 SV=1
5	Q8IW75	5.72e-17	85.1	414	0.173	0.203	SPA12_HUMAN Serpin A12 OS=Homo sapiens OX=9606 GN=SERPINA12 PE=1 SV=1
6	P20848	1.03e-16	84.3	421	0.198	0.228	A1ATR_HUMAN Alpha-1-antitrypsin-related protein OS=Homo sapiens OX=9606 GN=SERPINA2 PE=1 SV=2
7	P08185	2.49e-16	83.2	405	0.169	0.202	CBG_HUMAN Corticosteroid-binding globulin OS=Homo sapiens OX=9606 GN=SERPINA6 PE=1 SV=1
8	Q66HL5	1.90e-15	80.5	406	0.138	0.165	Q66HL5_RAT Serine (Or cysteine) peptidase inhibitor, clade A, member 5 OS=Rattus norvegicus OX=10116 GN=Serpina5 PE=2 SV=1
9	F1QQ04	1.99e-15	80.5	405	0.097	0.116	F1QQ04_DANRE Serpin H1 precursor OS=Danio rerio OX=7955 GN=cb216 PE=1 SV=2
10	O75830	2.03e-15	80.1	405	0.126	0.151	SPI2_HUMAN Serpin I2 OS=Homo sapiens OX=9606 GN=SERPINI2 PE=1 SV=1
11	F7EMJ6	2.09e-15	80.1	410	0.138	0.163	F7EMJ6_RAT Serpin family A member 5 OS=Rattus norvegicus OX=10116 GN=Serpina5 PE=3 SV=2
12	P50454	3.66e-15	79.7	418	0.097	0.112	SERPH_HUMAN Serpin H1 OS=Homo sapiens OX=9606 GN=SERPINH1 PE=1 SV=2
13	P35577	6.35e-15	79.0	418	0.181	0.211	THBG_RAT Thyroxine-binding globulin OS=Rattus norvegicus OX=10116 GN=Serpina7 PE=1 SV=2
14	Q9Z1W7	1.02e-14	78.2	417	0.095	0.110	Q9Z1W7_CRIGR Serpin H1 OS=Cricetulus griseus OX=10029 GN=Serpinh1 PE=2 SV=1
15	Q00898	1.11e-14	78.2	413	0.216	0.254	A1AT5_MOUSE Alpha-1-antitrypsin 1-5 OS=Mus musculus OX=10090 GN=Serpina1e PE=1 SV=1
16	P05154	1.67e-14	77.4	406	0.181	0.217	IPSP_HUMAN Plasma serine protease inhibitor OS=Homo sapiens OX=9606 GN=SERPINA5 PE=1 SV=3
17	P22599	2.62e-14	77.0	413	0.204	0.240	A1AT2_MOUSE Alpha-1-antitrypsin 1-2 OS=Mus musculus OX=10090 GN=Serpina1b PE=1 SV=2
18	P07758	4.00e-14	76.3	413	0.210	0.247	A1AT1_MOUSE Alpha-1-antitrypsin 1-1 OS=Mus musculus OX=10090 GN=Serpina1a PE=1 SV=4
19	P29457	4.19e-14	76.3	417	0.097	0.113	SERPH_RAT Serpin H1 OS=Rattus norvegicus OX=10116 GN=Serpinh1 PE=1 SV=1
20	E9KL23	4.95e-14	76.3	418	0.173	0.201	E9KL23_HUMAN Epididymis secretory sperm binding protein Li 44a OS=Homo sapiens OX=9606 GN=SERPINA1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08495 FIST	2.3e+02	13.2	FIST N domain
2	PF00079 Serpin	1.4e-54	197.5	Serpin (serine protease inhibitor)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355627

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000272190	0.999	Renin
2	9606.ENSP00000290866	0.998	Angiotensin-converting enzyme
3	9606.ENSP00000360973	0.998	Type-2 angiotensin II receptor
4	9606.ENSP00000389326	0.998	Angiotensin-converting enzyme 2
5	9606.ENSP00000419422	0.993	Type-1 angiotensin II receptor
6	9606.ENSP00000367697	0.987	Renin receptor
7	9606.ENSP00000368683	0.981	Endothelin-1
8	9606.ENSP00000250378	0.971	Chymase
9	9606.ENSP00000312134	0.966	Bone marrow proteoglycan
10	9606.ENSP00000265162	0.963	Glutamyl aminopeptidase
11	9606.ENSP00000308541	0.962	Prothrombin
12	9606.ENSP00000263025	0.957	Mitogen-activated protein kinase 3
13	9606.ENSP00000418525	0.957	Neprilysin
14	9606.ENSP00000362680	0.956	Proto-oncogene tyrosine-protein kinase Src
15	9606.ENSP00000216336	0.954	Cathepsin G
16	9606.ENSP00000286548	0.947	Guanine nucleotide-binding protein G(q) subunit alpha
17	9606.ENSP00000385523	0.939	Peroxisome proliferator-activated receptor alpha
18	9606.ENSP00000387760	0.939	Angiotensin-converting enzyme
19	9606.ENSP00000305372	0.938	Beta-2 adrenergic receptor
20	9606.ENSP00000078429	0.935	Guanine nucleotide-binding protein subunit alpha-11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004867	1.000	serine-type endopeptidase inhibitor activity
GO:0005179	0.998	hormone activity
GO:0001664	0.610	G protein-coupled receptor binding
GO:0008083	0.566	growth factor activity
GO:0017080	0.496	sodium channel regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0048522	0.991	positive regulation of cellular process
GO:0050896	0.988	response to stimulus
GO:0032501	0.985	multicellular organismal process
GO:0051239	0.979	regulation of multicellular organismal process
GO:0050793	0.963	regulation of developmental process
GO:0019222	0.951	regulation of metabolic process
GO:0070887	0.944	cellular response to chemical stimulus
GO:0051049	0.942	regulation of transport
GO:0008015	0.941	blood circulation
GO:0065008	0.939	regulation of biological quality
GO:0048583	0.933	regulation of response to stimulus
GO:0031328	0.933	positive regulation of cellular biosynthetic process
GO:0008217	0.932	regulation of blood pressure
GO:0010646	0.930	regulation of cell communication
GO:0071310	0.929	cellular response to organic substance
GO:0007154	0.926	cell communication
GO:0048519	0.921	negative regulation of biological process
GO:0007165	0.921	signal transduction
GO:0080090	0.913	regulation of primary metabolic process
GO:0032101	0.913	regulation of response to external stimulus
GO:0060255	0.909	regulation of macromolecule metabolic process
GO:0044093	0.907	positive regulation of molecular function
GO:0009966	0.903	regulation of signal transduction
GO:0048856	0.898	anatomical structure development
GO:0048584	0.897	positive regulation of response to stimulus
GO:0051246	0.897	regulation of protein metabolic process
GO:0003073	0.896	regulation of systemic arterial blood pressure
GO:0010468	0.889	regulation of gene expression
GO:0009967	0.889	positive regulation of signal transduction
GO:0050886	0.887	endocrine process
GO:0051094	0.882	positive regulation of developmental process
GO:0048523	0.881	negative regulation of cellular process
GO:0043085	0.877	positive regulation of catalytic activity
GO:1902531	0.861	regulation of intracellular signal transduction
GO:0044092	0.852	negative regulation of molecular function
GO:0001990	0.850	regulation of systemic arterial blood pressure by hormone
GO:0051173	0.848	positive regulation of nitrogen compound metabolic process
GO:0010604	0.847	positive regulation of macromolecule metabolic process
GO:1902533	0.837	positive regulation of intracellular signal transduction
GO:0051240	0.836	positive regulation of multicellular organismal process
GO:0080134	0.833	regulation of response to stress
GO:0043408	0.832	regulation of MAPK cascade
GO:0071495	0.826	cellular response to endogenous stimulus
GO:0051338	0.818	regulation of transferase activity
GO:0035556	0.817	intracellular signal transduction
GO:1901700	0.812	response to oxygen-containing compound
GO:0043549	0.810	regulation of kinase activity
GO:0001932	0.802	regulation of protein phosphorylation
GO:0007275	0.801	multicellular organism development
GO:0042981	0.794	regulation of apoptotic process
GO:0051179	0.784	localization
GO:0051248	0.776	negative regulation of protein metabolic process
GO:0045859	0.776	regulation of protein kinase activity
GO:0043410	0.765	positive regulation of MAPK cascade
GO:0051050	0.762	positive regulation of transport
GO:0043086	0.748	negative regulation of catalytic activity
GO:0003018	0.739	vascular process in circulatory system
GO:0035296	0.739	regulation of tube diameter
GO:0048585	0.733	negative regulation of response to stimulus
GO:0097746	0.731	blood vessel diameter maintenance
GO:0051241	0.730	negative regulation of multicellular organismal process
GO:0040012	0.719	regulation of locomotion
GO:0010556	0.717	regulation of macromolecule biosynthetic process
GO:0051128	0.711	regulation of cellular component organization
GO:0019219	0.711	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.697	regulation of RNA metabolic process
GO:0042127	0.688	regulation of cell population proliferation
GO:1903506	0.688	regulation of nucleic acid-templated transcription
GO:0048513	0.686	animal organ development
GO:0010243	0.679	response to organonitrogen compound
GO:0044057	0.675	regulation of system process
GO:0051234	0.659	establishment of localization
GO:0048731	0.659	system development
GO:0051130	0.647	positive regulation of cellular component organization
GO:2000145	0.621	regulation of cell motility
GO:0034762	0.620	regulation of transmembrane transport
GO:0032870	0.620	cellular response to hormone stimulus
GO:2000377	0.617	regulation of reactive oxygen species metabolic process
GO:0000003	0.612	reproduction
GO:0006810	0.611	transport
GO:2000379	0.602	positive regulation of reactive oxygen species metabolic process
GO:0010959	0.596	regulation of metal ion transport
GO:0043434	0.596	response to peptide hormone
GO:0022603	0.589	regulation of anatomical structure morphogenesis
GO:1901701	0.569	cellular response to oxygen-containing compound
GO:0019953	0.524	sexual reproduction
GO:0030334	0.505	regulation of cell migration
GO:0046903	0.473	secretion
GO:0006950	0.465	response to stress
GO:0022414	0.455	reproductive process
GO:0032940	0.451	secretion by cell
GO:0007186	0.408	G protein-coupled receptor signaling pathway
GO:0006355	0.393	regulation of DNA-templated transcription
GO:1901699	0.380	cellular response to nitrogen compound
GO:0003014	0.349	renal system process
GO:0031347	0.323	regulation of defense response
GO:2000147	0.313	positive regulation of cell motility

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.998	extracellular space
GO:0005737	0.997	cytoplasm
GO:0043227	0.966	membrane-bounded organelle
GO:0005886	0.956	plasma membrane
GO:0005829	0.949	cytosol
GO:0070062	0.869	extracellular exosome
GO:0043231	0.777	intracellular membrane-bounded organelle
GO:0030312	0.635	external encapsulating structure
GO:0031012	0.629	extracellular matrix
GO:0062023	0.614	collagen-containing extracellular matrix
GO:0070013	0.540	intracellular organelle lumen
GO:0012505	0.526	endomembrane system
GO:0072562	0.514	blood microparticle
GO:0031410	0.321	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]