StarFunc result for job id P01023

User Input

>input (1474 residues)
MGKNKLLHPSLVLLLLVLLPTDASVSGKPQYMVLVPSLLHTETTEKGCVLLSYLNETVTV
SASLESVRGNRSLFTDLEAENDVLHCVAFAVPKSSSNEEVMFLTVQVKGPTQEFKKRTTV
MVKNEDSLVFVQTDKSIYKPGQTVKFRVVSMDENFHPLNELIPLVYIQDPKGNRIAQWQS
FQLEGGLKQFSFPLSSEPFQGSYKVVVQKKSGGRTEHPFTVEEFVLPKFEVQVTVPKIIT
ILEEEMNVSVCGLYTYGKPVPGHVTVSICRKYSDASDCHGEDSQAFCEKFSGQLNSHGCF
YQQVKTKVFQLKRKEYEMKLHTEAQIQEEGTVVELTGRQSSEITRTITKLSFVKVDSHFR
QGIPFFGQVRLVDGKGVPIPNKVIFIRGNEANYYSNATTDEHGLVQFSINTTNVMGTSLT
VRVNYKDRSPCYGYQWVSEEHEEAHHTAYLVFSPSKSFVHLEPMSHELPCGHTQTVQAHY
ILNGGTLLGLKKLSFYYLIMAKGGIVRTGTHGLLVKQEDMKGHFSISIPVKSDIAPVARL
LIYAVLPTGDVIGDSAKYDVENCLANKVDLSFSPSQSLPASHAHLRVTAAPQSVCALRAV
DQSVLLMKPDAELSASSVYNLLPEKDLTGFPGPLNDQDNEDCINRHNVYINGITYTPVSS
TNEKDMYSFLEDMGLKAFTNSKIRKPKMCPQLQQYEMHGPEGLRVGFYESDVMGRGHARL
VHVEEPHTETVRKYFPETWIWDLVVVNSAGVAEVGVTVPDTITEWKAGAFCLSEDAGLGI
SSTASLRAFQPFFVELTMPYSVIRGEAFTLKATVLNYLPKCIRVSVQLEASPAFLAVPVE
KEQAPHCICANGRQTVSWAVTPKSLGNVNFTVSAEALESQELCGTEVPSVPEHGRKDTVI
KPLLVEPEGLEKETTFNSLLCPSGGEVSEELSLKLPPNVVEESARASVSVLGDILGSAMQ
NTQNLLQMPYGCGEQNMVLFAPNIYVLDYLNETQQLTPEIKSKAIGYLNTGYQRQLNYKH
YDGSYSTFGERYGRNQGNTWLTAFVLKTFAQARAYIFIDEAHITQALIWLSQRQKDNGCF
RSSGSLLNNAIKGGVEDEVTLSAYITIALLEIPLTVTHPVVRNALFCLESAWKTAQEGDH
GSHVYTKALLAYAFALAGNQDKRKEVLKSLNEEAVKKDNSVHWERPQKPKAPVGHFYEPQ
APSAEVEMTSYVLLAYLTAQPAPTSEDLTSATNIVKWITKQQNAQGGFSSTQDTVVALHA
LSKYGAATFTRTGKAAQVTIQSSGTFSSKFQVDNNNRLLLQQVSLPELPGEYSMKVTGEG
CVYLQTSLKYNILPEKEEFPFALGVQTLPQTCDEPKAHTSFQISLSVSYTGSRSASNMAI
VDVKMVSGFIPLKPTVKMLERSNHVSRTEVSSNHVLIYLDKVSNQTLSLFFTVLQDVPVR
DLKPAIVKVYDYYETDEFAIAEYNAPCSKDLGNA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7q1yA	0.858	0.918	0.000	1374	0.397	0.426	7q1yA.pdb.gz
2	PDB:7q5zA	0.828	0.904	0.000	1344	0.390	0.428	7q5zA.pdb.gz
3	PDB:7vonA	0.901	0.948	0.000	1399	0.935	0.985	7vonA.pdb.gz
4	AFDB:A0A0R4IDD1	0.862	0.879	0.000	1442	0.383	0.391	A0A0R4IDD1.pdb.gz
5	AFDB:A8K2U0	0.905	0.917	0.000	1454	0.401	0.406	A8K2U0.pdb.gz	A2ML1_HUMAN Alpha-2-macroglobulin-like protein 1 OS=Homo sapiens OX=9606 GN=A2ML1 PE=1 SV=3
6	AFDB:P01023	1.000	1.000	0.000	1474	1.000	1.000	P01023.pdb.gz	A2MG_HUMAN Alpha-2-macroglobulin OS=Homo sapiens OX=9606 GN=A2M PE=1 SV=3
7	AFDB:P20742	0.964	0.959	0.000	1482	0.722	0.718	P20742.pdb.gz	PZP_HUMAN Pregnancy zone protein OS=Homo sapiens OX=9606 GN=PZP PE=1 SV=4
8	AFDB:P28665	0.920	0.918	0.000	1476	0.588	0.587	P28665.pdb.gz	MUG1_MOUSE Murinoglobulin-1 OS=Mus musculus OX=10090 GN=Mug1 PE=1 SV=3
9	AFDB:Q03626	0.934	0.926	0.000	1487	0.591	0.586	Q03626.pdb.gz	MUG1_RAT Murinoglobulin-1 OS=Rattus norvegicus OX=10116 GN=Mug1 PE=2 SV=1
10	AFDB:Q61838	0.956	0.943	0.000	1495	0.592	0.584	Q61838.pdb.gz	PZP_MOUSE Pregnancy zone protein OS=Mus musculus OX=10090 GN=Pzp PE=1 SV=3
11	AFDB:Q63041	0.955	0.939	0.000	1500	0.588	0.578	Q63041.pdb.gz	A1M_RAT Alpha-1-macroglobulin OS=Rattus norvegicus OX=10116 GN=A1m PE=1 SV=1
12	AFDB:Q6GQT1	0.956	0.956	0.000	1474	0.723	0.723	Q6GQT1.pdb.gz	A2MG_MOUSE Alpha-2-macroglobulin-P OS=Mus musculus OX=10090 GN=A2m PE=2 SV=2
13	AFDB:Q6YHK3	0.827	0.842	0.000	1445	0.269	0.275	Q6YHK3.pdb.gz	CD109_HUMAN CD109 antigen OS=Homo sapiens OX=9606 GN=CD109 PE=1 SV=2
14	PDB:4lnvA	0.609	0.694	6.467E-83	1276	0.206	0.238	4lnvA.pdb.gz
15	PDB:7nycA	0.422	0.406	1.104E-71	1542	0.208	0.198	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
16	PDB:4lnvB	0.569	0.767	1.813E-62	1063	0.178	0.247	4lnvB.pdb.gz
17	PDB:6h03A	0.417	0.493	3.257E-60	1223	0.184	0.222	6h03A.pdb.gz
18	PDB:5a42A	0.492	0.460	2.806E-56	1597	0.145	0.133	5a42A.pdb.gz
19	PDB:4ziqA	0.332	0.337	3.115E-53	1450	0.144	0.146	4ziqA.pdb.gz
20	PDB:4rtdA	0.334	0.411	1.116E-45	1122	0.128	0.168	4rtdA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8K2U0	0.0	1090	1454	0.406	0.411	A2ML1_HUMAN Alpha-2-macroglobulin-like protein 1 OS=Homo sapiens OX=9606 GN=A2ML1 PE=1 SV=3
2	B8QSI4	0.0	976	1442	0.389	0.398	B8QSI4_DANRE Alpha-2 macroglobulin-like protein OS=Danio rerio OX=7955 GN=A2ML PE=1 SV=1
3	P01023	0.0	3059	1474	1.000	1.000	A2MG_HUMAN Alpha-2-macroglobulin OS=Homo sapiens OX=9606 GN=A2M PE=1 SV=3
4	P06238	0.0	2222	1472	0.731	0.732	A2MG_RAT Alpha-2-macroglobulin OS=Rattus norvegicus OX=10116 GN=A2m PE=2 SV=2
5	P20742	0.0	2177	1482	0.720	0.717	PZP_HUMAN Pregnancy zone protein OS=Homo sapiens OX=9606 GN=PZP PE=1 SV=4
6	P28665	0.0	1781	1476	0.592	0.591	MUG1_MOUSE Murinoglobulin-1 OS=Mus musculus OX=10090 GN=Mug1 PE=1 SV=3
7	Q03626	0.0	1787	1487	0.597	0.592	MUG1_RAT Murinoglobulin-1 OS=Rattus norvegicus OX=10116 GN=Mug1 PE=2 SV=1
8	Q61838	0.0	1687	1495	0.597	0.589	PZP_MOUSE Pregnancy zone protein OS=Mus musculus OX=10090 GN=Pzp PE=1 SV=3
9	Q63041	0.0	1701	1500	0.590	0.579	A1M_RAT Alpha-1-macroglobulin OS=Rattus norvegicus OX=10116 GN=A1m PE=1 SV=1
10	Q6GQT1	0.0	2175	1474	0.718	0.718	A2MG_MOUSE Alpha-2-macroglobulin-P OS=Mus musculus OX=10090 GN=A2m PE=2 SV=2
11	Q7SIH1	0.0	2369	1510	0.793	0.774	A2MG_BOVIN Alpha-2-macroglobulin OS=Bos taurus OX=9913 GN=A2M PE=1 SV=2
12	Q9NFV7	3.62e-152	501	1420	0.277	0.287	Q9NFV7_DROME GH01829p OS=Drosophila melanogaster OX=7227 GN=Tep2 PE=1 SV=1
13	Q6YHK3	9.02e-147	487	1445	0.299	0.305	CD109_HUMAN CD109 antigen OS=Homo sapiens OX=9606 GN=CD109 PE=1 SV=2
14	Q8R422	2.96e-118	407	1442	0.210	0.214	CD109_MOUSE CD109 antigen OS=Mus musculus OX=10090 GN=Cd109 PE=1 SV=1
15	Q9VLY7	1.17e-101	359	1469	0.261	0.262	Q9VLY7_DROME GH05679p OS=Drosophila melanogaster OX=7227 GN=Tep3 PE=1 SV=2
16	Q9NFV6	5.02e-101	357	1469	0.263	0.264	Q9NFV6_DROME TEP3 protein OS=Drosophila melanogaster OX=7227 GN=Tep3 PE=2 SV=1
17	Q9VIT9	8.96e-95	339	1496	0.196	0.193	Q9VIT9_DROME Thioester-containing protein 4, isoform A OS=Drosophila melanogaster OX=7227 GN=Tep4 PE=1 SV=2
18	M9PD73	1.72e-94	338	1476	0.197	0.197	M9PD73_DROME Thioester-containing protein 4, isoform B OS=Drosophila melanogaster OX=7227 GN=Tep4 PE=1 SV=1
19	Q9NFV5	1.92e-94	338	1496	0.196	0.193	Q9NFV5_DROME TEP4 protein OS=Drosophila melanogaster OX=7227 GN=Tep4 PE=2 SV=1
20	M9PDR0	2.48e-93	335	1498	0.195	0.192	M9PDR0_DROME Thioester-containing protein 4, isoform C OS=Drosophila melanogaster OX=7227 GN=Tep4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00207 A2M	4.2e-28	108.3	Alpha-2-macroglobulin family
2	PF07703 A2M_BRD	3.3e-28	110.2	Alpha-2-macroglobulin bait region domain
3	PF07677 A2M_recep	2.7e-23	93.7	A-macroglobulin receptor binding domain
4	PF02369 Big_1	1.6	20.1	Bacterial Ig-like domain (group 1)
5	PF17790 MG1	6.5	18.4	Macroglobulin domain MG1
6	PF01835 MG2	6.9e-17	73.0	MG2 domain
7	PF17791 MG3	1.1e-24	97.8	Macroglobulin domain MG3
8	PF17789 MG4	1.1e-24	97.9	Macroglobulin domain MG4
9	PF01107 MP	3.6e+02	12.1	Viral movement protein (MP)
10	PF14875 PIP49_N	1.7e+02	13.5	N-term cysteine-rich ER, FAM69
11	PF05326 SVA	0.026	25.9	Seminal vesicle autoantigen (SVA)
12	PF07678 TED_complement	3.7e-120	412.3	A-macroglobulin TED domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000323929

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000324173	0.998	78 kDa glucose-regulated protein
2	9606.ENSP00000243077	0.997	Prolow-density lipoprotein receptor-related protein 1
3	9606.ENSP00000314151	0.990	Prostate-specific antigen
4	9606.ENSP00000326159	0.990	Kallikrein-4
5	9606.ENSP00000471894	0.981	Hepcidin
6	9606.ENSP00000264690	0.976	Plasma kallikrein
7	9606.ENSP00000236850	0.973	Apolipoprotein A-I
8	9606.ENSP00000263341	0.969	Interleukin-1 beta
9	9606.ENSP00000466090	0.967	Neutrophil elastase
10	9606.ENSP00000412237	0.939	Interleukin-10
11	9606.ENSP00000219070	0.937	72 kDa type IV collagenase
12	9606.ENSP00000295897	0.935	Serum albumin
13	9606.ENSP00000450540	0.929	Alpha-1-antichymotrypsin
14	9606.ENSP00000250378	0.903	Chymase
15	9606.ENSP00000356671	0.895	Antithrombin-III
16	9606.ENSP00000348170	0.893	Haptoglobin
17	9606.ENSP00000416066	0.888	Alpha-1-antitrypsin
18	9606.ENSP00000322788	0.883	Interstitial collagenase
19	9606.ENSP00000358525	0.879	Beta-nerve growth factor
20	9606.ENSP00000345672	0.878	Cathepsin B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030414	1.000	peptidase inhibitor activity
GO:0004866	0.960	endopeptidase inhibitor activity
GO:0019899	0.890	enzyme binding
GO:0002020	0.857	protease binding
GO:0019838	0.824	growth factor binding
GO:0005102	0.673	signaling receptor binding
GO:0019955	0.390	cytokine binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.968	regulation of biological process
GO:0050896	0.911	response to stimulus
GO:0048583	0.901	regulation of response to stimulus
GO:0048519	0.845	negative regulation of biological process
GO:0009987	0.839	cellular process
GO:0032501	0.810	multicellular organismal process
GO:0002682	0.701	regulation of immune system process
GO:0032101	0.629	regulation of response to external stimulus
GO:0050776	0.597	regulation of immune response
GO:0032502	0.503	developmental process
GO:0080134	0.469	regulation of response to stress
GO:0019222	0.452	regulation of metabolic process
GO:0006950	0.436	response to stress
GO:0048585	0.414	negative regulation of response to stimulus
GO:0050794	0.402	regulation of cellular process
GO:0002920	0.394	regulation of humoral immune response
GO:0060255	0.372	regulation of macromolecule metabolic process
GO:0048856	0.359	anatomical structure development
GO:0031347	0.325	regulation of defense response
GO:0032102	0.318	negative regulation of response to external stimulus
GO:0048518	0.313	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.999	cell periphery
GO:0005615	0.999	extracellular space
GO:0031982	0.998	vesicle
GO:0070013	0.974	intracellular organelle lumen
GO:0030312	0.970	external encapsulating structure
GO:0012505	0.940	endomembrane system
GO:0043231	0.914	intracellular membrane-bounded organelle
GO:0005737	0.901	cytoplasm
GO:0070062	0.870	extracellular exosome
GO:0031012	0.774	extracellular matrix
GO:0031410	0.765	cytoplasmic vesicle
GO:0062023	0.762	collagen-containing extracellular matrix
GO:0030141	0.729	secretory granule
GO:0072562	0.721	blood microparticle
GO:0060205	0.675	cytoplasmic vesicle lumen
GO:0034774	0.586	secretory granule lumen
GO:0016020	0.477	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]