StarFunc result for job id P01024

User Input

>input (1663 residues)
MGPTSGPSLLLLLLTHLPLALGSPMYSIITPNILRLESEETMVLEAHDAQGDVPVTVTVH
DFPGKKLVLSSEKTVLTPATNHMGNVTFTIPANREFKSEKGRNKFVTVQATFGTQVVEKV
VLVSLQSGYLFIQTDKTIYTPGSTVLYRIFTVNHKLLPVGRTVMVNIENPEGIPVKQDSL
SSQNQLGVLPLSWDIPELVNMGQWKIRAYYENSPQQVFSTEFEVKEYVLPSFEVIVEPTE
KFYYIYNEKGLEVTITARFLYGKKVEGTAFVIFGIQDGEQRISLPESLKRIPIEDGSGEV
VLSRKVLLDGVQNPRAEDLVGKSLYVSATVILHSGSDMVQAERSGIPIVTSPYQIHFTKT
PKYFKPGMPFDLMVFVTNPDGSPAYRVPVAVQGEDTVQSLTQGDGVAKLSINTHPSQKPL
SITVRTKKQELSEAEQATRTMQALPYSTVGNSNNYLHLSVLRTELRPGETLNVNFLLRMD
RAHEAKIRYYTYLIMNKGRLLKAGRQVREPGQDLVVLPLSITTDFIPSFRLVAYYTLIGA
SGQREVVADSVWVDVKDSCVGSLVVKSGQSEDRQPVPGQQMTLKIEGDHGARVVLVAVDK
GVFVLNKKNKLTQSKIWDVVEKADIGCTPGSGKDYAGVFSDAGLTFTSSSGQQTAQRAEL
QCPQPAARRRRSVQLTEKRMDKVGKYPKELRKCCEDGMRENPMRFSCQRRTRFISLGEAC
KKVFLDCCNYITELRRQHARASHLGLARSNLDEDIIAEENIVSRSEFPESWLWNVEDLKE
PPKNGISTKLMNIFLKDSITTWEILAVSMSDKKGICVADPFEVTVMQDFFIDLRLPYSVV
RNEQVEIRAVLYNYRQNQELKVRVELLHNPAFCSLATTKRRHQQTVTIPPKSSLSVPYVI
VPLKTGLQEVEVKAAVYHHFISDGVRKSLKVVPEGIRMNKTVAVRTLDPERLGREGVQKE
DIPPADLSDQVPDTESETRILLQGTPVAQMTEDAVDAERLKHLIVTPSGCGEQNMIGMTP
TVIAVHYLDETEQWEKFGLEKRQGALELIKKGYTQQLAFRQPSSAFAAFVKRAPSTWLTA
YVVKVFSLAVNLIAIDSQVLCGAVKWLILEKQKPDGVFQEDAPVIHQEMIGGLRNNNEKD
MALTAFVLISLQEAKDICEEQVNSLPGSITKAGDFLEANYMNLQRSYTVAIAGYALAQMG
RLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEATSYALLALLQLKDFDFVPPVVRWLNEQR
YYGGGYGSTQATFMVFQALAQYQKDAPDHQELNLDVSLQLPSRSSKITHRIHWESASLLR
SEETKENEGFTVTAEGKGQGTLSVVTMYHAKAKDQLTCNKFDLKVTIKPAPETEKRPQDA
KNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSD
RNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDG
KLNKLCRDELCRCAEENCFIQKSDDKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDE
YIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSY
IIGKDTWVEHWPEEDECQDEENQKQCQDLGAFTESMVVFGCPN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B8JKW4	0.559	0.565	0.000	1643	0.425	0.430	B8JKW4.pdb.gz
2	AFDB:P01024	1.000	1.000	0.000	1663	1.000	1.000	P01024.pdb.gz	CO3_HUMAN Complement C3 OS=Homo sapiens OX=9606 GN=C3 PE=1 SV=2
3	AFDB:P01025	0.994	0.995	0.000	1661	0.764	0.765	P01025.pdb.gz	CO3_PIG Complement C3 OS=Sus scrofa OX=9823 GN=C3 PE=1 SV=2
4	AFDB:P01026	0.984	0.984	0.000	1663	0.773	0.773	P01026.pdb.gz	CO3_RAT Complement C3 OS=Rattus norvegicus OX=10116 GN=C3 PE=1 SV=3
5	AFDB:P01029	0.474	0.456	0.000	1738	0.295	0.283	P01029.pdb.gz	CO4B_MOUSE Complement C4-B OS=Mus musculus OX=10090 GN=C4b PE=1 SV=3
6	AFDB:P01031	0.808	0.803	0.000	1676	0.278	0.276	P01031.pdb.gz	CO5_HUMAN Complement C5 OS=Homo sapiens OX=9606 GN=C5 PE=1 SV=4
7	AFDB:P06684	0.804	0.797	0.000	1680	0.271	0.268	P06684.pdb.gz	CO5_MOUSE Complement C5 OS=Mus musculus OX=10090 GN=C5 PE=1 SV=2
8	AFDB:P98093	0.589	0.595	0.000	1640	0.435	0.441	P98093.pdb.gz	CO3_ONCMY Complement C3 (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=c3 PE=1 SV=1
9	AFDB:Q91132	0.526	0.532	0.000	1642	0.486	0.493	Q91132.pdb.gz	VCO3_NAJKA Cobra venom factor OS=Naja kaouthia OX=8649 PE=1 SV=1
10	AFDB:P08649	0.467	0.449	1.511E-103	1737	0.290	0.278	P08649.pdb.gz	CO4_RAT Complement C4 OS=Rattus norvegicus OX=10116 GN=C4 PE=1 SV=3
11	PDB:7nycA	0.448	0.476	5.088E-84	1542	0.260	0.281	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
12	PDB:7q1yA	0.623	0.738	7.636E-73	1374	0.197	0.238	7q1yA.pdb.gz
13	PDB:7q5zA	0.617	0.744	2.308E-68	1344	0.198	0.245	7q5zA.pdb.gz
14	PDB:7vonA	0.626	0.729	1.994E-66	1399	0.204	0.242	7vonA.pdb.gz
15	PDB:4lnvA	0.501	0.633	5.129E-66	1276	0.184	0.240	4lnvA.pdb.gz
16	PDB:6h03A	0.415	0.554	4.768E-65	1223	0.212	0.289	6h03A.pdb.gz
17	PDB:4lnvB	0.478	0.716	1.274E-49	1063	0.162	0.253	4lnvB.pdb.gz
18	PDB:5a42A	0.452	0.468	1.741E-45	1597	0.126	0.131	5a42A.pdb.gz
19	PDB:4ziqA	0.320	0.354	2.478E-40	1450	0.122	0.140	4ziqA.pdb.gz
20	PDB:4rtdA	0.320	0.441	5.344E-35	1122	0.112	0.166	4rtdA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1SBS4	0.0	2581	1642	0.756	0.766	F1SBS4_PIG Complement C3 OS=Sus scrofa OX=9823 GN=C3 PE=1 SV=4
2	P01024	0.0	3459	1663	1.000	1.000	CO3_HUMAN Complement C3 OS=Homo sapiens OX=9606 GN=C3 PE=1 SV=2
3	P01025	0.0	2643	1661	0.765	0.766	CO3_PIG Complement C3 OS=Sus scrofa OX=9823 GN=C3 PE=1 SV=2
4	P01026	0.0	2689	1663	0.771	0.771	CO3_RAT Complement C3 OS=Rattus norvegicus OX=10116 GN=C3 PE=1 SV=3
5	P01027	0.0	2665	1663	0.769	0.769	CO3_MOUSE Complement C3 OS=Mus musculus OX=10090 GN=C3 PE=1 SV=3
6	P01029	0.0	658	1738	0.301	0.288	CO4B_MOUSE Complement C4-B OS=Mus musculus OX=10090 GN=C4b PE=1 SV=3
7	P01031	0.0	667	1676	0.286	0.283	CO5_HUMAN Complement C5 OS=Homo sapiens OX=9606 GN=C5 PE=1 SV=4
8	P06684	0.0	661	1680	0.289	0.286	CO5_MOUSE Complement C5 OS=Mus musculus OX=10090 GN=C5 PE=1 SV=2
9	P08649	0.0	661	1737	0.304	0.291	CO4_RAT Complement C4 OS=Rattus norvegicus OX=10116 GN=C4 PE=1 SV=3
10	P08650	0.0	666	1681	0.284	0.281	CO5_RAT Complement C5 OS=Rattus norvegicus OX=10116 GN=C5 PE=1 SV=3
11	P0C0L4	0.0	644	1744	0.301	0.287	CO4A_HUMAN Complement C4-A OS=Homo sapiens OX=9606 GN=C4A PE=1 SV=2
12	P0C0L5	0.0	648	1744	0.300	0.286	CO4B_HUMAN Complement C4-B OS=Homo sapiens OX=9606 GN=C4B PE=1 SV=2
13	P98093	0.0	1358	1640	0.441	0.447	CO3_ONCMY Complement C3 (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=c3 PE=1 SV=1
14	Q3MU74	0.0	1342	1651	0.437	0.440	Q3MU74_DANRE Complement component C3-1 OS=Danio rerio OX=7955 GN=C3-1 PE=1 SV=1
15	Q6MG90	0.0	654	1737	0.301	0.288	Q6MG90_RAT Complement C4B (Chido blood group) OS=Rattus norvegicus OX=10116 GN=C4b PE=4 SV=1
16	Q90633	0.0	1763	1652	0.533	0.536	Q90633_CHICK Complement C3 OS=Gallus gallus OX=9031 PE=2 SV=1
17	Q91132	0.0	1650	1642	0.495	0.502	VCO3_NAJKA Cobra venom factor OS=Naja kaouthia OX=8649 PE=1 SV=1
18	Q98977	0.0	1259	1614	0.419	0.431	Q98977_ONCMY Complement component C3-3 (Fragment) OS=Oncorhynchus mykiss OX=8022 PE=2 SV=2
19	Q9DDV9	0.0	904	1684	0.288	0.284	Q9DDV9_ONCMY Complement component C3-4 (Fragment) OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
20	Q076D6	6.98e-173	568	1665	0.276	0.276	Q076D6_CHICK MHC-linked complement C4 OS=Gallus gallus OX=9031 GN=C4-2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00207 A2M	1.1e-26	103.8	Alpha-2-macroglobulin family
2	PF07703 A2M_BRD	1.4e-21	88.7	Alpha-2-macroglobulin bait region domain
3	PF07677 A2M_recep	4.4e-27	105.9	A-macroglobulin receptor binding domain
4	PF01821 ANATO	1.2e-07	43.9	Anaphylotoxin-like domain
5	PF09707 Cas_Cas2CT1978	5.1e+02	12.2	CRISPR-associated protein (Cas_Cas2CT1978)
6	PF17790 MG1	3.2e-25	99.7	Macroglobulin domain MG1
7	PF01835 MG2	2.5e-14	64.8	MG2 domain
8	PF17791 MG3	2.8e-10	51.7	Macroglobulin domain MG3
9	PF17789 MG4	2.3e-24	96.8	Macroglobulin domain MG4
10	PF01759 NTR	5.8e-24	95.3	UNC-6/NTR/C345C module
11	PF07678 TED_complement	4.4e-72	254.3	A-macroglobulin TED domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000245907

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000247153	0.999	Properdin
2	9606.ENSP00000313875	0.999	Membrane cofactor protein
3	9606.ENSP00000314299	0.999	Complement factor H-related protein 1
4	9606.ENSP00000356016	0.999	Complement receptor type 1
5	9606.ENSP00000356399	0.999	Complement factor H
6	9606.ENSP00000363869	0.999	V-set and immunoglobulin domain-containing protein 4
7	9606.ENSP00000378130	0.999	Complement factor I
8	9606.ENSP00000416561	0.999	Complement factor B
9	9606.ENSP00000356030	0.998	Complement decay-accelerating factor
10	9606.ENSP00000302079	0.997	C3a anaphylatoxin chemotactic receptor
11	9606.ENSP00000356024	0.997	Complement receptor type 2
12	9606.ENSP00000356386	0.997	Complement factor H-related protein 4
13	9606.ENSP00000441691	0.996	Integrin alpha-M
14	9606.ENSP00000256785	0.994	Complement factor H-related protein 5
15	9606.ENSP00000332139	0.994	Complement factor D
16	9606.ENSP00000410815	0.993	Complement factor B
17	9606.ENSP00000263686	0.989	P-selectin
18	9606.ENSP00000356395	0.979	Complement factor H-related protein 3
19	9606.ENSP00000454623	0.969	Integrin alpha-X
20	9606.ENSP00000380948	0.968	Integrin beta-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.876	signaling receptor binding
GO:0001664	0.773	G protein-coupled receptor binding
GO:0098772	0.504	molecular function regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.994	response to stimulus
GO:0050789	0.983	regulation of biological process
GO:0009605	0.974	response to external stimulus
GO:0048518	0.963	positive regulation of biological process
GO:0006955	0.959	immune response
GO:0006950	0.931	response to stress
GO:0009987	0.901	cellular process
GO:0048583	0.872	regulation of response to stimulus
GO:0050794	0.869	regulation of cellular process
GO:0044419	0.766	biological process involved in interspecies interaction between organisms
GO:0006952	0.742	defense response
GO:0002684	0.736	positive regulation of immune system process
GO:0050776	0.725	regulation of immune response
GO:0009607	0.705	response to biotic stimulus
GO:0050778	0.700	positive regulation of immune response
GO:0043207	0.643	response to external biotic stimulus
GO:0006959	0.570	humoral immune response
GO:0002252	0.527	immune effector process
GO:0048522	0.501	positive regulation of cellular process
GO:0002253	0.487	activation of immune response
GO:0051707	0.468	response to other organism
GO:0006956	0.463	complement activation
GO:0032501	0.446	multicellular organismal process
GO:0019222	0.434	regulation of metabolic process
GO:0051239	0.418	regulation of multicellular organismal process
GO:0051716	0.414	cellular response to stimulus
GO:0008152	0.403	metabolic process
GO:0009893	0.398	positive regulation of metabolic process
GO:0060255	0.393	regulation of macromolecule metabolic process
GO:0071704	0.341	organic substance metabolic process
GO:0098542	0.336	defense response to other organism
GO:0007154	0.328	cell communication
GO:0042221	0.315	response to chemical
GO:0032879	0.313	regulation of localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.998	extracellular space
GO:0031982	0.952	vesicle
GO:0071944	0.917	cell periphery
GO:0070062	0.892	extracellular exosome
GO:0016020	0.840	membrane
GO:0005622	0.741	intracellular anatomical structure
GO:0005737	0.725	cytoplasm
GO:0043231	0.722	intracellular membrane-bounded organelle
GO:0032991	0.704	protein-containing complex
GO:0012505	0.645	endomembrane system
GO:0043233	0.568	organelle lumen
GO:0070013	0.562	intracellular organelle lumen
GO:0005886	0.442	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]