StarFunc result for job id P01031

User Input

>input (1676 residues)
MGLLGILCFLIFLGKTWGQEQTYVISAPKIFRVGASENIVIQVYGYTEAFDATISIKSYP
DKKFSYSSGHVHLSSENKFQNSAILTIQPKQLPGGQNPVSYVYLEVVSKHFSKSKRMPIT
YDNGFLFIHTDKPVYTPDQSVKVRVYSLNDDLKPAKRETVLTFIDPEGSEVDMVEEIDHI
GIISFPDFKIPSNPRYGMWTIKAKYKEDFSTTGTAYFEVKEYVLPHFSVSIEPEYNFIGY
KNFKNFEITIKARYFYNKVVTEADVYITFGIREDLKDDQKEMMQTAMQNTMLINGIAQVT
FDSETAVKELSYYSLEDLNNKYLYIAVTVIESTGGFSEEAEIPGIKYVLSPYKLNLVATP
LFLKPGIPYPIKVQVKDSLDQLVGGVPVTLNAQTIDVNQETSDLDPSKSVTRVDDGVASF
VLNLPSGVTVLEFNVKTDAPDLPEENQAREGYRAIAYSSLSQSYLYIDWTDNHKALLVGE
HLNIIVTPKSPYIDKITHYNYLILSKGKIIHFGTREKFSDASYQSINIPVTQNMVPSSRL
LVYYIVTGEQTAELVSDSVWLNIEEKCGNQLQVHLSPDADAYSPGQTVSLNMATGMDSWV
ALAAVDSAVYGVQRGAKKPLERVFQFLEKSDLGCGAGGGLNNANVFHLAGLTFLTNANAD
DSQENDEPCKEILRPRRTLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISL
GPRCIKAFTECCVVASQLRANISHKDMQLGRLHMKTLLPVSKPEIRSYFPESWLWEVHLV
PRRKQLQFALPDSLTTWEIQGVGISNTGICVADTVKAKVFKDVFLEMNIPYSVVRGEQIQ
LKGTVYNYRTSGMQFCVKMSAVEGICTSESPVIDHQGTKSSKCVRQKVEGSSSHLVTFTV
LPLEIGLHNINFSLETWFGKEILVKTLRVVPEGVKRESYSGVTLDPRGIYGTISRRKEFP
YRIPLDLVPKTEIKRILSVKGLLVGEILSAVLSQEGINILTHLPKGSAEAELMSVVPVFY
VFHYLETGNHWNIFHSDPLIEKQKLKKKLKEGMLSIMSYRNADYSYSVWKGGSASTWLTA
FALRVLGQVNKYVEQNQNSICNSLLWLVENYQLDNGSFKENSQYQPIKLQGTLPVEAREN
SLYLTAFTVIGIRKAFDICPLVKIDTALIKADNFLLENTLPAQSTFTLAISAYALSLGDK
THPQFRSIVSALKREALVKGNPPIYRFWKDNLQHKDSSVPNTGTARMVETTAYALLTSLN
LKDINYVNPVIKWLSEEQRYGGGFYSTQDTINAIEGLTEYSLLVKQLRLSMDIDVSYKHK
GALHNYKMTDKNFLGRPVEVLLNDDLIVSTGFGSGLATVHVTTVVHKTSTSEEVCSFYLK
IDTQDIEASHYRGYGNSDYKRIVACASYKPSREESSSGSSHAVMDISLPTGISANEEDLK
ALVEGVDQLFTDYQIKDGHVILQLNSIPSSDFLCVRFRIFELFEVGFLSPATFTVYEYHR
PDKQCTMFYSTSNIKIQKVCEGAACKCVEADCGQMQEELDLTISAETRKQTACKPEIAYA
YKVSITSITVENVFVKYKATLLDIYKTGEAVAEKDSEITFIKKVTCTNAELVKGRQYLIM
GKEALQIKYNFSFRYIYPLDSLTWIEYWPRDTTCSSCQAFLANLDEFAEDIFLNGC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6h03A	0.418	0.558	0.000	1223	0.727	0.996	6h03A.pdb.gz
2	PDB:7nycA	0.485	0.519	0.000	1542	0.919	0.999	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
3	AFDB:B8JKW4	0.509	0.517	0.000	1643	0.269	0.274	B8JKW4.pdb.gz
4	AFDB:P01024	0.804	0.810	0.000	1663	0.276	0.278	P01024.pdb.gz	CO3_HUMAN Complement C3 OS=Homo sapiens OX=9606 GN=C3 PE=1 SV=2
5	AFDB:P01025	0.812	0.819	0.000	1661	0.278	0.281	P01025.pdb.gz	CO3_PIG Complement C3 OS=Sus scrofa OX=9823 GN=C3 PE=1 SV=2
6	AFDB:P01026	0.820	0.826	0.000	1663	0.283	0.286	P01026.pdb.gz	CO3_RAT Complement C3 OS=Rattus norvegicus OX=10116 GN=C3 PE=1 SV=3
7	AFDB:P01031	1.000	1.000	0.000	1676	1.000	1.000	P01031.pdb.gz	CO5_HUMAN Complement C5 OS=Homo sapiens OX=9606 GN=C5 PE=1 SV=4
8	AFDB:P06684	0.977	0.975	0.000	1680	0.778	0.776	P06684.pdb.gz	CO5_MOUSE Complement C5 OS=Mus musculus OX=10090 GN=C5 PE=1 SV=2
9	AFDB:Q91132	0.501	0.510	0.000	1642	0.279	0.284	Q91132.pdb.gz	VCO3_NAJKA Cobra venom factor OS=Naja kaouthia OX=8649 PE=1 SV=1
10	AFDB:P98093	0.522	0.532	1.097E-103	1640	0.269	0.275	P98093.pdb.gz	CO3_ONCMY Complement C3 (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=c3 PE=1 SV=1
11	AFDB:P08649	0.467	0.453	7.844E-101	1737	0.260	0.250	P08649.pdb.gz	CO4_RAT Complement C4 OS=Rattus norvegicus OX=10116 GN=C4 PE=1 SV=3
12	AFDB:P01029	0.470	0.456	1.944E-99	1738	0.252	0.243	P01029.pdb.gz	CO4B_MOUSE Complement C4-B OS=Mus musculus OX=10090 GN=C4b PE=1 SV=3
13	PDB:7q1yA	0.650	0.778	4.178E-71	1374	0.183	0.223	7q1yA.pdb.gz
14	PDB:7q5zA	0.649	0.792	3.313E-65	1344	0.178	0.222	7q5zA.pdb.gz
15	PDB:7vonA	0.639	0.752	2.555E-63	1399	0.187	0.224	7vonA.pdb.gz
16	PDB:4lnvA	0.522	0.667	9.297E-63	1276	0.175	0.230	4lnvA.pdb.gz
17	PDB:4lnvB	0.493	0.751	4.198E-48	1063	0.146	0.230	4lnvB.pdb.gz
18	PDB:5a42A	0.440	0.459	1.812E-45	1597	0.109	0.115	5a42A.pdb.gz
19	PDB:4ziqA	0.283	0.316	2.001E-42	1450	0.105	0.121	4ziqA.pdb.gz
20	PDB:4rtdA	0.286	0.390	5.209E-34	1122	0.099	0.148	4rtdA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1SBS4	0.0	649	1642	0.282	0.287	F1SBS4_PIG Complement C3 OS=Sus scrofa OX=9823 GN=C3 PE=1 SV=4
2	P01024	0.0	677	1663	0.283	0.286	CO3_HUMAN Complement C3 OS=Homo sapiens OX=9606 GN=C3 PE=1 SV=2
3	P01025	0.0	674	1661	0.284	0.287	CO3_PIG Complement C3 OS=Sus scrofa OX=9823 GN=C3 PE=1 SV=2
4	P01026	0.0	649	1663	0.283	0.286	CO3_RAT Complement C3 OS=Rattus norvegicus OX=10116 GN=C3 PE=1 SV=3
5	P01027	0.0	659	1663	0.280	0.282	CO3_MOUSE Complement C3 OS=Mus musculus OX=10090 GN=C3 PE=1 SV=3
6	P01031	0.0	3478	1676	1.000	1.000	CO5_HUMAN Complement C5 OS=Homo sapiens OX=9606 GN=C5 PE=1 SV=4
7	P06684	0.0	2760	1680	0.779	0.777	CO5_MOUSE Complement C5 OS=Mus musculus OX=10090 GN=C5 PE=1 SV=2
8	P08650	0.0	2825	1681	0.797	0.794	CO5_RAT Complement C5 OS=Rattus norvegicus OX=10116 GN=C5 PE=1 SV=3
9	P98093	0.0	617	1640	0.294	0.300	CO3_ONCMY Complement C3 (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=c3 PE=1 SV=1
10	Q3MU74	0.0	598	1651	0.281	0.285	Q3MU74_DANRE Complement component C3-1 OS=Danio rerio OX=7955 GN=C3-1 PE=1 SV=1
11	Q90633	0.0	678	1652	0.292	0.296	Q90633_CHICK Complement C3 OS=Gallus gallus OX=9031 PE=2 SV=1
12	Q91132	0.0	649	1642	0.291	0.297	VCO3_NAJKA Cobra venom factor OS=Naja kaouthia OX=8649 PE=1 SV=1
13	Q98977	2.18e-179	585	1614	0.283	0.294	Q98977_ONCMY Complement component C3-3 (Fragment) OS=Oncorhynchus mykiss OX=8022 PE=2 SV=2
14	Q90XS7	1.99e-177	554	745	0.184	0.415	Q90XS7_ONCMY Complement component C5 (Fragment) OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
15	P01029	1.00e-141	483	1738	0.257	0.247	CO4B_MOUSE Complement C4-B OS=Mus musculus OX=10090 GN=C4b PE=1 SV=3
16	P08649	1.58e-125	436	1737	0.210	0.203	CO4_RAT Complement C4 OS=Rattus norvegicus OX=10116 GN=C4 PE=1 SV=3
17	Q6MG90	5.55e-125	434	1737	0.211	0.204	Q6MG90_RAT Complement C4B (Chido blood group) OS=Rattus norvegicus OX=10116 GN=C4b PE=4 SV=1
18	Q076D6	4.25e-123	427	1665	0.206	0.207	Q076D6_CHICK MHC-linked complement C4 OS=Gallus gallus OX=9031 GN=C4-2 PE=2 SV=1
19	P0C0L5	4.39e-120	419	1744	0.212	0.204	CO4B_HUMAN Complement C4-B OS=Homo sapiens OX=9606 GN=C4B PE=1 SV=2
20	P0C0L4	4.31e-119	417	1744	0.210	0.202	CO4A_HUMAN Complement C4-A OS=Homo sapiens OX=9606 GN=C4A PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00207 A2M	4e-24	95.6	Alpha-2-macroglobulin family
2	PF07703 A2M_BRD	3.9e-22	90.6	Alpha-2-macroglobulin bait region domain
3	PF07677 A2M_recep	6e-22	89.4	A-macroglobulin receptor binding domain
4	PF01821 ANATO	2.1e-05	36.6	Anaphylotoxin-like domain
5	PF17790 MG1	2.2e-25	100.2	Macroglobulin domain MG1
6	PF01835 MG2	2e-11	55.5	MG2 domain
7	PF17791 MG3	3.3e-09	48.2	Macroglobulin domain MG3
8	PF17789 MG4	1.7e-20	84.4	Macroglobulin domain MG4
9	PF01759 NTR	7.4e-21	85.3	UNC-6/NTR/C345C module
10	PF07678 TED_complement	1.2e-84	295.6	A-macroglobulin TED domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000223642

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354458	0.999	Complement component C8 alpha chain
2	9606.ENSP00000360281	0.999	Complement component C8 beta chain
3	9606.ENSP00000263408	0.998	Complement component C9
4	9606.ENSP00000263413	0.998	Complement component C6
5	9606.ENSP00000322061	0.998	Complement component C7
6	9606.ENSP00000347197	0.998	C5a anaphylatoxin chemotactic receptor 1
7	9606.ENSP00000224181	0.994	Complement component C8 gamma chain
8	9606.ENSP00000299367	0.967	Complement C2
9	9606.ENSP00000416561	0.962	Complement factor B
10	9606.ENSP00000181383	0.959	Carboxypeptidase B2
11	9606.ENSP00000247153	0.951	Properdin
12	9606.ENSP00000308541	0.945	Prothrombin
13	9606.ENSP00000359446	0.944	Carboxypeptidase N catalytic chain
14	9606.ENSP00000466090	0.932	Neutrophil elastase
15	9606.ENSP00000396688	0.929	Complement C4-A
16	9606.ENSP00000415941	0.929	Complement C4-B
17	9606.ENSP00000319464	0.909	Carboxypeptidase N subunit 2
18	9606.ENSP00000302079	0.906	C3a anaphylatoxin chemotactic receptor
19	9606.ENSP00000225174	0.900	Peptidyl-prolyl cis-trans isomerase F, mitochondrial
20	9606.ENSP00000265333	0.900	Voltage-dependent anion-selective channel protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0001664	1.000	G protein-coupled receptor binding
GO:0098772	0.998	molecular function regulator activity
GO:0048018	0.989	receptor ligand activity
GO:0005125	0.979	cytokine activity
GO:0042379	0.866	chemokine receptor binding
GO:0008009	0.831	chemokine activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048583	0.996	regulation of response to stimulus
GO:0050896	0.992	response to stimulus
GO:0050794	0.984	regulation of cellular process
GO:0048518	0.984	positive regulation of biological process
GO:0009987	0.979	cellular process
GO:0006955	0.971	immune response
GO:0048584	0.954	positive regulation of response to stimulus
GO:0006950	0.934	response to stress
GO:0051239	0.897	regulation of multicellular organismal process
GO:0048519	0.885	negative regulation of biological process
GO:0032101	0.875	regulation of response to external stimulus
GO:0006952	0.852	defense response
GO:0048523	0.851	negative regulation of cellular process
GO:0009605	0.831	response to external stimulus
GO:0060255	0.817	regulation of macromolecule metabolic process
GO:0051716	0.803	cellular response to stimulus
GO:0010468	0.796	regulation of gene expression
GO:0002684	0.775	positive regulation of immune system process
GO:0032102	0.752	negative regulation of response to external stimulus
GO:0051240	0.738	positive regulation of multicellular organismal process
GO:0040012	0.716	regulation of locomotion
GO:0009893	0.700	positive regulation of metabolic process
GO:0007154	0.672	cell communication
GO:0050920	0.656	regulation of chemotaxis
GO:0030334	0.628	regulation of cell migration
GO:0040013	0.619	negative regulation of locomotion
GO:0006959	0.594	humoral immune response
GO:0023052	0.590	signaling
GO:0002685	0.589	regulation of leukocyte migration
GO:0050778	0.574	positive regulation of immune response
GO:0042221	0.547	response to chemical
GO:0002253	0.543	activation of immune response
GO:0002252	0.542	immune effector process
GO:2000146	0.509	negative regulation of cell motility
GO:0006956	0.504	complement activation
GO:0030336	0.501	negative regulation of cell migration
GO:0001817	0.490	regulation of cytokine production
GO:0040011	0.475	locomotion
GO:0010604	0.456	positive regulation of macromolecule metabolic process
GO:0007165	0.449	signal transduction
GO:0010628	0.427	positive regulation of gene expression
GO:0032501	0.424	multicellular organismal process
GO:0006954	0.391	inflammatory response
GO:0048522	0.337	positive regulation of cellular process
GO:0042330	0.317	taxis
GO:0065008	0.308	regulation of biological quality

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0043226	0.988	organelle
GO:0043227	0.976	membrane-bounded organelle
GO:0005886	0.974	plasma membrane
GO:0032991	0.964	protein-containing complex
GO:0031982	0.934	vesicle
GO:0098796	0.907	membrane protein complex
GO:0070062	0.901	extracellular exosome
GO:0046930	0.819	pore complex
GO:0043231	0.752	intracellular membrane-bounded organelle
GO:0098797	0.727	plasma membrane protein complex
GO:0005737	0.695	cytoplasm
GO:0012505	0.443	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]