StarFunc result for job id P01033

User Input

>input (207 residues)
MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQR
YEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHIT
TCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEK
GFQSRHLACLPREPGLCTWQSLRSQIA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P01033	1.000	1.000	1.081E-46	207	1.000	1.000	P01033.pdb.gz	TIMP1_HUMAN Metalloproteinase inhibitor 1 OS=Homo sapiens OX=9606 GN=TIMP1 PE=1 SV=1
2	AFDB:P12032	0.941	0.950	1.670E-35	205	0.725	0.732	P12032.pdb.gz	TIMP1_MOUSE Metalloproteinase inhibitor 1 OS=Mus musculus OX=10090 GN=Timp1 PE=1 SV=2
3	PDB:1ueaB	0.829	0.943	2.205E-35	181	0.865	0.989	1ueaB.pdb.gz	Mechanism of inhibition of the human matrix metalloproteinase stromelysin-1 by TIMP-1.
4	AFDB:P30120	0.898	0.859	1.586E-34	217	0.705	0.673	P30120.pdb.gz	TIMP1_RAT Metalloproteinase inhibitor 1 OS=Rattus norvegicus OX=10116 GN=Timp1 PE=1 SV=2
5	AFDB:P35625	0.790	0.776	3.996E-24	211	0.372	0.365	P35625.pdb.gz	TIMP3_HUMAN Metalloproteinase inhibitor 3 OS=Homo sapiens OX=9606 GN=TIMP3 PE=1 SV=2
6	AFDB:Q64HW8	0.757	0.715	9.590E-24	220	0.377	0.355	Q64HW8.pdb.gz	Q64HW8_ONCMY TIMP metallopeptidase inhibitor 2b OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
7	AFDB:P81556	0.808	0.751	1.311E-23	224	0.372	0.344	P81556.pdb.gz	TIMP4_RAT Metalloproteinase inhibitor 4 OS=Rattus norvegicus OX=10116 GN=Timp4 PE=2 SV=2
8	AFDB:P16035	0.736	0.695	6.664E-23	220	0.401	0.377	P16035.pdb.gz	TIMP2_HUMAN Metalloproteinase inhibitor 2 OS=Homo sapiens OX=9606 GN=TIMP2 PE=1 SV=2
9	AFDB:Q1MTE8	0.757	0.715	6.664E-23	220	0.353	0.332	Q1MTE8.pdb.gz
10	AFDB:A0A2R8Q0U9	0.758	0.691	2.561E-19	229	0.271	0.245	A0A2R8Q0U9.pdb.gz	A0A2R8Q0U9_DANRE Metalloproteinase inhibitor 2-like OS=Danio rerio OX=7955 GN=timp4.1 PE=3 SV=1
11	PDB:1gxdC	0.723	0.775	3.418E-18	192	0.353	0.380	1gxdC.pdb.gz	Structural Insight Into the Complex Formation of Latent Matrix Metalloproteinase 2 with Tissue Inhibitor of Metalloproteinase 2
12	AFDB:Q9VH14	0.695	0.686	2.515E-15	210	0.237	0.233	Q9VH14.pdb.gz	TIMP_DROME Tissue inhibitor of metalloproteinase OS=Drosophila melanogaster OX=7227 GN=Timp PE=1 SV=1
13	PDB:3jd5L	0.220	0.362	4.345E-2	109	0.058	0.110	3jd5L.pdb.gz	Cryo-EM structure of the small subunit of the mammalian mitochondrial ribosome.
14	PDB:7pu7A	0.164	0.042	1.182E-1	1070	0.077	0.015	7pu7A.pdb.gz	DNA-Dependent Binding of Nargenicin to DnaE1 Inhibits Replication in Mycobacterium tuberculosis.
15	PDB:8d0bA	0.264	0.061	1.616E-1	1116	0.087	0.016	8d0bA.pdb.gz	Structures of the human CST-Pol alpha-primase complex bound to telomere templates.
16	PDB:2pi2A	0.220	0.317	1.720E-1	129	0.048	0.078	2pi2A.pdb.gz
17	PDB:2m9vA	0.157	0.179	2.075E-1	170	0.063	0.076	2m9vA.pdb.gz
18	PDB:7qwsK	0.168	0.095	2.075E-1	426	0.053	0.026	7qwsK.pdb.gz	Mechanism of signal sequence handover from NAC to SRP on ribosomes during ER-protein targeting.
19	PDB:6fyxi	0.248	0.362	2.351E-1	121	0.048	0.083	6fyxi.pdb.gz	Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
20	PDB:3apxA	0.138	0.155	2.664E-1	179	0.058	0.067	3apxA.pdb.gz	Structural insights into differences in drug-binding selectivity between two forms of human alpha1-acid glycoprotein genetic variants, the A and F1*S forms.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P01033	2.75e-156	432	207	1.000	1.000	TIMP1_HUMAN Metalloproteinase inhibitor 1 OS=Homo sapiens OX=9606 GN=TIMP1 PE=1 SV=1
2	P12032	7.73e-104	299	205	0.725	0.732	TIMP1_MOUSE Metalloproteinase inhibitor 1 OS=Mus musculus OX=10090 GN=Timp1 PE=1 SV=2
3	P30120	8.72e-101	292	217	0.705	0.673	TIMP1_RAT Metalloproteinase inhibitor 1 OS=Rattus norvegicus OX=10116 GN=Timp1 PE=1 SV=2
4	Q64HW8	2.28e-45	151	220	0.372	0.350	Q64HW8_ONCMY TIMP metallopeptidase inhibitor 2b OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
5	P25785	3.22e-45	151	220	0.382	0.359	TIMP2_MOUSE Metalloproteinase inhibitor 2 OS=Mus musculus OX=10090 GN=Timp2 PE=1 SV=2
6	P30121	4.26e-45	150	220	0.382	0.359	TIMP2_RAT Metalloproteinase inhibitor 2 OS=Rattus norvegicus OX=10116 GN=Timp2 PE=1 SV=3
7	P16035	2.33e-44	149	220	0.377	0.355	TIMP2_HUMAN Metalloproteinase inhibitor 2 OS=Homo sapiens OX=9606 GN=TIMP2 PE=1 SV=2
8	Q7SZM6	2.34e-43	146	220	0.362	0.341	Q7SZM6_DANRE Metalloproteinase inhibitor 2 precursor OS=Danio rerio OX=7955 GN=etID32613.12 PE=2 SV=1
9	P35625	2.88e-43	146	211	0.377	0.370	TIMP3_HUMAN Metalloproteinase inhibitor 3 OS=Homo sapiens OX=9606 GN=TIMP3 PE=1 SV=2
10	P39876	9.49e-43	144	211	0.372	0.365	TIMP3_MOUSE Metalloproteinase inhibitor 3 OS=Mus musculus OX=10090 GN=Timp3 PE=1 SV=1
11	P48032	1.28e-42	144	211	0.372	0.365	TIMP3_RAT Metalloproteinase inhibitor 3 OS=Rattus norvegicus OX=10116 GN=Timp3 PE=2 SV=1
12	Q9JHB3	1.24e-40	139	224	0.377	0.348	TIMP4_MOUSE Metalloproteinase inhibitor 4 OS=Mus musculus OX=10090 GN=Timp4 PE=2 SV=1
13	P81556	1.04e-39	137	224	0.372	0.344	TIMP4_RAT Metalloproteinase inhibitor 4 OS=Rattus norvegicus OX=10116 GN=Timp4 PE=2 SV=2
14	A0A2R8Q0U9	9.94e-24	96.3	229	0.295	0.266	A0A2R8Q0U9_DANRE Metalloproteinase inhibitor 2-like OS=Danio rerio OX=7955 GN=timp4.1 PE=3 SV=1
15	Q9VH14	3.85e-10	59.3	210	0.179	0.176	TIMP_DROME Tissue inhibitor of metalloproteinase OS=Drosophila melanogaster OX=7227 GN=Timp PE=1 SV=1
16	Q19319	1.1	32.7	4328	0.116	0.006	CADH4_CAEEL Cadherin-4 OS=Caenorhabditis elegans OX=6239 GN=cdh-4 PE=1 SV=4
17	Q60716	2.9	31.2	537	0.097	0.037	P4HA2_MOUSE Prolyl 4-hydroxylase subunit alpha-2 OS=Mus musculus OX=10090 GN=P4ha2 PE=1 SV=1
18	O15460	3.3	30.8	535	0.097	0.037	P4HA2_HUMAN Prolyl 4-hydroxylase subunit alpha-2 OS=Homo sapiens OX=9606 GN=P4HA2 PE=1 SV=1
19	O75051	6.0	30.4	1894	0.193	0.021	PLXA2_HUMAN Plexin-A2 OS=Homo sapiens OX=9606 GN=PLXNA2 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00965 TIMP	1e-62	222.7	Tissue inhibitor of metalloproteinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000218388

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000219070	0.999	72 kDa type IV collagenase
2	9606.ENSP00000299855	0.999	Stromelysin-1
3	9606.ENSP00000308208	0.999	Matrix metalloproteinase-14
4	9606.ENSP00000322788	0.999	Interstitial collagenase
5	9606.ENSP00000361405	0.999	Matrix metalloproteinase-9
6	9606.ENSP00000447730	0.996	CD63 antigen
7	9606.ENSP00000265983	0.989	Hemopexin
8	9606.ENSP00000279441	0.980	Stromelysin-2
9	9606.ENSP00000385675	0.974	Interleukin-6
10	9606.ENSP00000362108	0.966	Neutrophil gelatinase-associated lipocalin
11	9606.ENSP00000412237	0.964	Interleukin-10
12	9606.ENSP00000264498	0.963	Fibroblast growth factor 2
13	9606.ENSP00000417050	0.959	Tetraspanin
14	9606.ENSP00000398632	0.958	CD44 antigen
15	9606.ENSP00000264657	0.952	Signal transducer and activator of transcription 3
16	9606.ENSP00000162749	0.950	Tumor necrosis factor receptor superfamily member 1A
17	9606.ENSP00000344192	0.950	Interleukin-17A
18	9606.ENSP00000215781	0.944	Oncostatin-M
19	9606.ENSP00000384906	0.937	Serum amyloid A-1 protein
20	9606.ENSP00000260227	0.936	Matrilysin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008191	1.000	metalloendopeptidase inhibitor activity
GO:0008270	0.997	zinc ion binding
GO:0005125	0.996	cytokine activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.999	response to stimulus
GO:0050794	0.994	regulation of cellular process
GO:0009987	0.992	cellular process
GO:0060255	0.985	regulation of macromolecule metabolic process
GO:0080090	0.978	regulation of primary metabolic process
GO:0051171	0.978	regulation of nitrogen compound metabolic process
GO:0048519	0.964	negative regulation of biological process
GO:0051246	0.964	regulation of protein metabolic process
GO:0051716	0.925	cellular response to stimulus
GO:0065009	0.917	regulation of molecular function
GO:0048518	0.873	positive regulation of biological process
GO:0009892	0.861	negative regulation of metabolic process
GO:0048523	0.860	negative regulation of cellular process
GO:0050790	0.857	regulation of catalytic activity
GO:0048522	0.855	positive regulation of cellular process
GO:0030162	0.854	regulation of proteolysis
GO:0010605	0.842	negative regulation of macromolecule metabolic process
GO:0048583	0.832	regulation of response to stimulus
GO:0032501	0.725	multicellular organismal process
GO:0051172	0.713	negative regulation of nitrogen compound metabolic process
GO:0042127	0.654	regulation of cell population proliferation
GO:0023051	0.646	regulation of signaling
GO:0010646	0.642	regulation of cell communication
GO:0009966	0.616	regulation of signal transduction
GO:0032502	0.573	developmental process
GO:0051239	0.535	regulation of multicellular organismal process
GO:0048856	0.507	anatomical structure development
GO:0051248	0.491	negative regulation of protein metabolic process
GO:0009628	0.484	response to abiotic stimulus
GO:0023052	0.476	signaling
GO:0007154	0.476	cell communication
GO:0031323	0.473	regulation of cellular metabolic process
GO:0007165	0.463	signal transduction
GO:0006950	0.443	response to stress
GO:0042221	0.433	response to chemical
GO:0030334	0.422	regulation of cell migration
GO:0007275	0.382	multicellular organism development
GO:0045861	0.374	negative regulation of proteolysis
GO:0008284	0.365	positive regulation of cell population proliferation
GO:0010033	0.363	response to organic substance
GO:0051336	0.349	regulation of hydrolase activity
GO:0010468	0.349	regulation of gene expression
GO:0044092	0.337	negative regulation of molecular function
GO:0051241	0.332	negative regulation of multicellular organismal process
GO:0009893	0.312	positive regulation of metabolic process
GO:0043086	0.308	negative regulation of catalytic activity
GO:0050793	0.306	regulation of developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.998	extracellular space
GO:0005737	0.996	cytoplasm
GO:0043231	0.995	intracellular membrane-bounded organelle
GO:0070013	0.993	intracellular organelle lumen
GO:0012505	0.992	endomembrane system
GO:0031982	0.973	vesicle
GO:0030141	0.954	secretory granule
GO:0071944	0.913	cell periphery
GO:0070062	0.876	extracellular exosome
GO:0034774	0.863	secretory granule lumen
GO:0031012	0.509	extracellular matrix
GO:0005783	0.441	endoplasmic reticulum
GO:0031091	0.440	platelet alpha granule
GO:0062023	0.432	collagen-containing extracellular matrix
GO:0005788	0.399	endoplasmic reticulum lumen
GO:0016020	0.382	membrane
GO:0031093	0.337	platelet alpha granule lumen
GO:0031981	0.336	nuclear lumen
GO:0005654	0.318	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]