StarFunc result for job id P01034

User Input

>input (146 residues)
MAGPLRAPLLLLAILAVALAVSPAAGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEY
NKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRK
AFCSFQIYAVPWQGTMTLSKSTCQDA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P01034	1.000	1.000	6.549E-25	146	1.000	1.000	P01034.pdb.gz	CYTC_HUMAN Cystatin-C OS=Homo sapiens OX=9606 GN=CST3 PE=1 SV=1
2	AFDB:P14841	0.773	0.805	1.219E-19	140	0.705	0.736	P14841.pdb.gz	CYTC_RAT Cystatin-C OS=Rattus norvegicus OX=10116 GN=Cst3 PE=1 SV=2
3	AFDB:P21460	0.768	0.800	3.459E-19	140	0.692	0.721	P21460.pdb.gz	CYTC_MOUSE Cystatin-C OS=Mus musculus OX=10090 GN=Cst3 PE=1 SV=2
4	AFDB:P28325	0.743	0.764	1.452E-16	142	0.507	0.521	P28325.pdb.gz	CYTD_HUMAN Cystatin-D OS=Homo sapiens OX=9606 GN=CST5 PE=1 SV=1
5	AFDB:P09228	0.739	0.764	1.808E-16	141	0.562	0.582	P09228.pdb.gz	CYTT_HUMAN Cystatin-SA OS=Homo sapiens OX=9606 GN=CST2 PE=1 SV=1
6	AFDB:P01036	0.760	0.787	2.018E-16	141	0.555	0.574	P01036.pdb.gz	CYTS_HUMAN Cystatin-S OS=Homo sapiens OX=9606 GN=CST4 PE=1 SV=3
7	AFDB:P01037	0.752	0.778	7.962E-16	141	0.541	0.560	P01037.pdb.gz	CYTN_HUMAN Cystatin-SN OS=Homo sapiens OX=9606 GN=CST1 PE=1 SV=3
8	PDB:6rpvA	0.560	0.659	1.702E-15	120	0.815	0.992	6rpvA.pdb.gz
9	AFDB:P01038	0.736	0.772	1.466E-13	139	0.418	0.439	P01038.pdb.gz	CYT_CHICK Cystatin OS=Gallus gallus OX=9031 PE=1 SV=2
10	AFDB:Q9JM84	0.752	0.742	3.163E-13	148	0.336	0.331	Q9JM84.pdb.gz	CST10_MOUSE Cystatin 10 OS=Mus musculus OX=10090 GN=Cst10 PE=1 SV=1
11	AFDB:P19313	0.722	0.746	4.162E-13	141	0.384	0.397	P19313.pdb.gz	CYTS_RAT Cystatin-S OS=Rattus norvegicus OX=10116 GN=Cst4 PE=1 SV=2
12	PDB:1rn7A	0.725	0.938	5.155E-12	112	0.397	0.518	1rn7A.pdb.gz
13	PDB:1yvbI	0.725	0.943	1.052E-11	111	0.349	0.459	1yvbI.pdb.gz
14	PDB:2ch9A	0.705	0.809	1.056E-10	126	0.274	0.317	2ch9A.pdb.gz	Structural Basis of Reduction-Dependent Activation of Human Cystatin F.
15	PDB:6uioA	0.693	0.890	1.468E-10	112	0.247	0.321	6uioA.pdb.gz	Maturation of the functional mouse CRES amyloid from globular form.
16	PDB:4n6mA	0.691	0.849	3.534E-10	117	0.281	0.350	4n6mA.pdb.gz
17	PDB:3lh4A	0.616	0.761	2.722E-6	115	0.185	0.235	3lh4A.pdb.gz
18	PDB:6ht9B	0.641	0.312	2.208E-3	316	0.123	0.057	6ht9B.pdb.gz	Structure of mammalian plasma fetuin-B and its mechanism of selective metallopeptidase inhibition.
19	PDB:1nb3I	0.419	0.584	7.806E-3	98	0.130	0.194	1nb3I.pdb.gz	Crystal structure of stefin A in complex with cathepsin H: N-terminal residues of inhibitors can adapt to the active sites of endo- and exopeptidases
20	PDB:1stfI	0.407	0.572	1.428E-2	98	0.123	0.184	1stfI.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P01034	7.30e-108	305	146	1.000	1.000	CYTC_HUMAN Cystatin-C OS=Homo sapiens OX=9606 GN=CST3 PE=1 SV=1
2	P14841	2.77e-67	202	140	0.685	0.714	CYTC_RAT Cystatin-C OS=Rattus norvegicus OX=10116 GN=Cst3 PE=1 SV=2
3	P21460	4.42e-66	199	140	0.692	0.721	CYTC_MOUSE Cystatin-C OS=Mus musculus OX=10090 GN=Cst3 PE=1 SV=2
4	P01036	9.24e-49	155	141	0.473	0.489	CYTS_HUMAN Cystatin-S OS=Homo sapiens OX=9606 GN=CST4 PE=1 SV=3
5	P28325	8.31e-48	152	142	0.507	0.521	CYTD_HUMAN Cystatin-D OS=Homo sapiens OX=9606 GN=CST5 PE=1 SV=1
6	P01037	8.32e-48	152	141	0.459	0.475	CYTN_HUMAN Cystatin-SN OS=Homo sapiens OX=9606 GN=CST1 PE=1 SV=3
7	P09228	3.33e-44	144	141	0.473	0.489	CYTT_HUMAN Cystatin-SA OS=Homo sapiens OX=9606 GN=CST2 PE=1 SV=1
8	P01038	7.14e-39	130	139	0.390	0.410	CYT_CHICK Cystatin OS=Gallus gallus OX=9031 PE=1 SV=2
9	Q9JM84	9.14e-36	122	148	0.370	0.365	CST10_MOUSE Cystatin 10 OS=Mus musculus OX=10090 GN=Cst10 PE=1 SV=1
10	P19313	1.71e-35	121	141	0.397	0.411	CYTS_RAT Cystatin-S OS=Rattus norvegicus OX=10116 GN=Cst4 PE=1 SV=2
11	Q98967	6.29e-28	102	130	0.342	0.385	CYT_ONCKE Cystatin OS=Oncorhynchus keta OX=8018 PE=1 SV=2
12	Q91195	3.04e-27	100	130	0.329	0.369	CYT_ONCMY Cystatin OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
13	A0A060VN46	3.07e-27	100	132	0.329	0.364	A0A060VN46_ONCMY Uncharacterized protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00077770001 PE=4 SV=1
14	P32766	2.01e-22	88.6	142	0.336	0.345	CST8_MOUSE Cystatin-8 OS=Mus musculus OX=10090 GN=Cst8 PE=1 SV=2
15	O60676	9.71e-20	81.6	142	0.336	0.345	CST8_HUMAN Cystatin-8 OS=Homo sapiens OX=9606 GN=CST8 PE=1 SV=1
16	O89098	1.47e-19	81.3	144	0.260	0.264	CYTF_MOUSE Cystatin-F OS=Mus musculus OX=10090 GN=Cst7 PE=2 SV=1
17	O76096	1.89e-19	80.9	145	0.322	0.324	CYTF_HUMAN Cystatin-F OS=Homo sapiens OX=9606 GN=CST7 PE=1 SV=1
18	Q15828	7.58e-17	74.3	149	0.356	0.349	CYTM_HUMAN Cystatin-M OS=Homo sapiens OX=9606 GN=CST6 PE=1 SV=1
19	Q5W188	1.96e-14	67.8	147	0.226	0.224	CST9P_HUMAN Putative cystatin-9-like protein CST9LP1 OS=Homo sapiens OX=9606 GN=CST9LP1 PE=5 SV=1
20	Q2PDL1	3.29e-14	67.0	138	0.226	0.239	Q2PDL1_MACMU Epididymis-specific CRES-like protein OS=Macaca mulatta OX=9544 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00031 Cystatin	6.8e-26	101.7	Cystatin domain
2	PF16845 SQAPI	0.069	24.8	Aspartic acid proteinase inhibitor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000381448

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000345672	0.996	Cathepsin B
2	9606.ENSP00000345344	0.944	Cathepsin L1
3	9606.ENSP00000284981	0.886	Amyloid-beta A4 protein
4	9606.ENSP00000389814	0.881	Adiponectin
5	9606.ENSP00000295897	0.877	Serum albumin
6	9606.ENSP00000362108	0.876	Neutrophil gelatinase-associated lipocalin
7	9606.ENSP00000344844	0.874	Hepatitis A virus cellular receptor 1
8	9606.ENSP00000384906	0.862	Serum amyloid A-1 protein
9	9606.ENSP00000452780	0.862	Beta-2-microglobulin
10	9606.ENSP00000291568	0.823	Cystatin-B
11	9606.ENSP00000255030	0.806	C-reactive protein
12	9606.ENSP00000380432	0.791	Insulin
13	9606.ENSP00000360687	0.764	Prostaglandin-H2 D-isomerase
14	9606.ENSP00000367828	0.761	Integral membrane protein 2B
15	9606.ENSP00000237014	0.760	Transthyretin
16	9606.ENSP00000264474	0.758	Cystatin-A
17	9606.ENSP00000236671	0.757	Cathepsin D
18	9606.ENSP00000220166	0.755	Pro-cathepsin H
19	9606.ENSP00000376911	0.755	Legumain
20	9606.ENSP00000354850	0.734	Protein O-GlcNAcase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0002020	1.000	protease binding
GO:0004869	1.000	cysteine-type endopeptidase inhibitor activity
GO:0042802	0.811	identical protein binding
GO:0033218	0.773	amide binding
GO:0042277	0.760	peptide binding
GO:0001540	0.749	amyloid-beta binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0050896	0.993	response to stimulus
GO:0009987	0.985	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0048519	0.975	negative regulation of biological process
GO:0019222	0.972	regulation of metabolic process
GO:0080090	0.943	regulation of primary metabolic process
GO:0060255	0.931	regulation of macromolecule metabolic process
GO:0030162	0.923	regulation of proteolysis
GO:0048523	0.921	negative regulation of cellular process
GO:0031323	0.901	regulation of cellular metabolic process
GO:0010605	0.856	negative regulation of macromolecule metabolic process
GO:0051248	0.853	negative regulation of protein metabolic process
GO:0051336	0.712	regulation of hydrolase activity
GO:0032501	0.681	multicellular organismal process
GO:0006950	0.675	response to stress
GO:0051128	0.624	regulation of cellular component organization
GO:0048518	0.609	positive regulation of biological process
GO:0052547	0.576	regulation of peptidase activity
GO:0009894	0.572	regulation of catabolic process
GO:0045861	0.534	negative regulation of proteolysis
GO:0044092	0.495	negative regulation of molecular function
GO:0051239	0.483	regulation of multicellular organismal process
GO:0032502	0.467	developmental process
GO:0048856	0.449	anatomical structure development
GO:1903053	0.442	regulation of extracellular matrix organization
GO:0010712	0.414	regulation of collagen metabolic process
GO:0008152	0.388	metabolic process
GO:0043086	0.388	negative regulation of catalytic activity
GO:0042221	0.375	response to chemical
GO:0051716	0.341	cellular response to stimulus
GO:0048522	0.336	positive regulation of cellular process
GO:0009893	0.325	positive regulation of metabolic process
GO:0071840	0.315	cellular component organization or biogenesis
GO:0009895	0.313	negative regulation of catabolic process
GO:0010468	0.310	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.998	extracellular space
GO:0005737	0.997	cytoplasm
GO:0071944	0.996	cell periphery
GO:0012505	0.996	endomembrane system
GO:0031982	0.996	vesicle
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0070013	0.996	intracellular organelle lumen
GO:0070062	0.991	extracellular exosome
GO:0005886	0.980	plasma membrane
GO:0030141	0.971	secretory granule
GO:0062023	0.819	collagen-containing extracellular matrix
GO:0005788	0.732	endoplasmic reticulum lumen
GO:0060205	0.643	cytoplasmic vesicle lumen
GO:0034774	0.622	secretory granule lumen
GO:0101002	0.417	ficolin-1-rich granule
GO:0070820	0.384	tertiary granule
GO:0031981	0.379	nuclear lumen
GO:0005794	0.345	Golgi apparatus
GO:0005764	0.325	lysosome
GO:1904813	0.314	ficolin-1-rich granule lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]