StarFunc result for job id P01042

User Input

>input (644 residues)
MKLITILFLCSRLLLSLTQESQSEEIDCNDKDLFKAVDAALKKYNSQNQSNNQFVLYRIT
EATKTVGSDTFYSFKYEIKEGDCPVQSGKTWQDCEYKDAAKAATGECTATVGKRSSTKFS
VATQTCQITPAEGPVVTAQYDCLGCVHPISTQSPDLEPILRHGIQYFNNNTQHSSLFMLN
EVKRAQRQVVAGLNFRITYSIVQTNCSKENFLFLTPDCKSLWNGDTGECTDNAYIDIQLR
IASFSQNCDIYPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKLNAENNATFYFK
IDNVKKARVQVVAGKKYFIDFVARETTCSKESNEELTESCETKKLGQSLDCNAEVYVVPW
EKKIYPTVNCQPLGMISLMKRPPGFSPFRSSRIGEIKEETTVSPPHTSMAPAQDEERDSG
KEQGHTRRHDWGHEKQRKHNLGHGHKHERDQGHGHQRGHGLGHGHEQQHGLGHGHKFKLD
DDLEHQGGHVLDHGHKHKHGHGHGKHKNKGKKNGKHNGWKTEHLASSSEDSTTPSAQTQE
KTEGPTPIPSLAKPGVTVTFSDFQDSDLIATMMPPISPAPIQSDDDWIPDIQIDPNGLSF
NPISDFPDTTSPKCPGRPWKSVSEINPTTQMKESYYFDLTDGLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P01042	1.000	1.000	1.393E-103	644	1.000	1.000	P01042.pdb.gz	KNG1_HUMAN Kininogen-1 OS=Homo sapiens OX=9606 GN=KNG1 PE=1 SV=2
2	AFDB:O08677	0.335	0.328	2.168E-68	661	0.598	0.582	O08677.pdb.gz	KNG1_MOUSE Kininogen-1 OS=Mus musculus OX=10090 GN=Kng1 PE=1 SV=1
3	AFDB:P08934	0.321	0.323	2.812E-68	639	0.590	0.595	P08934.pdb.gz	KNG1_RAT Kininogen-1 OS=Rattus norvegicus OX=10116 GN=Kng1 PE=2 SV=1
4	PDB:6ht9B	0.181	0.326	1.382E-12	316	0.061	0.123	6ht9B.pdb.gz	Structure of mammalian plasma fetuin-B and its mechanism of selective metallopeptidase inhibition.
5	PDB:2ch9A	0.161	0.763	2.301E-8	126	0.056	0.286	2ch9A.pdb.gz	Structural Basis of Reduction-Dependent Activation of Human Cystatin F.
6	PDB:4n6mA	0.164	0.844	2.648E-7	117	0.050	0.274	4n6mA.pdb.gz
7	PDB:6uioA	0.154	0.817	1.472E-6	112	0.036	0.205	6uioA.pdb.gz	Maturation of the functional mouse CRES amyloid from globular form.
8	PDB:1yvbI	0.155	0.834	2.231E-6	111	0.047	0.270	1yvbI.pdb.gz
9	PDB:1wnhA	0.129	0.348	1.376E-5	220	0.040	0.118	1wnhA.pdb.gz
10	PDB:1rn7A	0.157	0.838	2.085E-5	112	0.042	0.241	1rn7A.pdb.gz
11	PDB:2bo9B	0.129	0.347	2.313E-5	217	0.045	0.134	2bo9B.pdb.gz	Structure of Human Carboxypeptidase A4 with its Endogenous Protein Inhibitor, Latexin.
12	PDB:3lh4A	0.155	0.753	1.044E-4	115	0.030	0.165	3lh4A.pdb.gz
13	PDB:6rpvA	0.138	0.602	2.399E-4	120	0.045	0.242	6rpvA.pdb.gz
14	AFDB:Q4ZHG4	0.068	0.033	3.211E-3	1894	0.101	0.034	Q4ZHG4.pdb.gz	FNDC1_HUMAN Fibronectin type III domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FNDC1 PE=2 SV=4
15	AFDB:Q2Q0I9	0.058	0.029	4.387E-3	1779	0.098	0.035	Q2Q0I9.pdb.gz	FNDC1_RAT Fibronectin type III domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Fndc1 PE=1 SV=2
16	AFDB:G5EC82	0.075	0.070	8.622E-3	711	0.109	0.098	G5EC82.pdb.gz	G5EC82_CAEEL Transmembrane protein RAM-5 OS=Caenorhabditis elegans OX=6239 GN=ram-5 PE=2 SV=1
17	AFDB:F1NDH9	0.065	0.059	1.178E-2	1148	0.112	0.063	F1NDH9.pdb.gz
18	AFDB:Q59FP8	0.056	0.038	1.695E-2	1130	0.135	0.077	Q59FP8.pdb.gz	Q59FP8_HUMAN Neogenin 1 (Fragment) OS=Homo sapiens OX=9606 GN=NEO1 PE=1 SV=1
19	AFDB:P42835	0.071	0.050	1.880E-2	1041	0.096	0.060	P42835.pdb.gz	EGT2_YEAST Protein EGT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EGT2 PE=2 SV=2
20	AFDB:Q96MS0	0.055	0.035	2.568E-2	1386	0.160	0.074	Q96MS0.pdb.gz	ROBO3_HUMAN Roundabout homolog 3 OS=Homo sapiens OX=9606 GN=ROBO3 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O08677	0.0	660	661	0.585	0.570	KNG1_MOUSE Kininogen-1 OS=Mus musculus OX=10090 GN=Kng1 PE=1 SV=1
2	P01042	0.0	1350	644	1.000	1.000	KNG1_HUMAN Kininogen-1 OS=Homo sapiens OX=9606 GN=KNG1 PE=1 SV=2
3	P08934	0.0	692	639	0.581	0.585	KNG1_RAT Kininogen-1 OS=Rattus norvegicus OX=10116 GN=Kng1 PE=2 SV=1
4	Q6S9I0	1.33e-172	500	433	0.390	0.580	Q6S9I0_MOUSE Kininogen 2 OS=Mus musculus OX=10090 GN=Kng2 PE=1 SV=1
5	A0A1S3PBB7	1.07e-31	129	375	0.138	0.237	KNG_SALSA Kininogen OS=Salmo salar OX=8030 GN=LOC106584303 PE=1 SV=1
6	Q5XJ76	3.57e-21	97.4	331	0.095	0.184	Q5XJ76_DANRE Kininogen 1 OS=Danio rerio OX=7955 GN=fb64g01 PE=1 SV=1
7	O89098	6.28e-13	68.6	144	0.062	0.278	CYTF_MOUSE Cystatin-F OS=Mus musculus OX=10090 GN=Cst7 PE=2 SV=1
8	O76096	7.91e-12	65.5	145	0.057	0.255	CYTF_HUMAN Cystatin-F OS=Homo sapiens OX=9606 GN=CST7 PE=1 SV=1
9	A0A060Y5T9	5.39e-11	67.8	491	0.110	0.145	A0A060Y5T9_ONCMY Cystatin fetuin-B-type domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00022832001 PE=4 SV=1
10	Q9UGM5	5.33e-10	63.9	382	0.076	0.128	FETUB_HUMAN Fetuin-B OS=Homo sapiens OX=9606 GN=FETUB PE=1 SV=2
11	Q9QXC1	1.82e-07	56.2	388	0.073	0.121	FETUB_MOUSE Fetuin-B OS=Mus musculus OX=10090 GN=Fetub PE=1 SV=1
12	Q15828	5.54e-07	51.6	149	0.054	0.235	CYTM_HUMAN Cystatin-M OS=Homo sapiens OX=9606 GN=CST6 PE=1 SV=1
13	P01034	7.66e-07	51.2	146	0.051	0.226	CYTC_HUMAN Cystatin-C OS=Homo sapiens OX=9606 GN=CST3 PE=1 SV=1
14	P21460	8.23e-07	50.8	140	0.047	0.214	CYTC_MOUSE Cystatin-C OS=Mus musculus OX=10090 GN=Cst3 PE=1 SV=2
15	P14841	1.14e-06	50.4	140	0.047	0.214	CYTC_RAT Cystatin-C OS=Rattus norvegicus OX=10116 GN=Cst3 PE=1 SV=2
16	P01038	7.58e-06	48.1	139	0.043	0.201	CYT_CHICK Cystatin OS=Gallus gallus OX=9031 PE=1 SV=2
17	B2Z450	1.91e-05	46.6	126	0.053	0.270	CYTC_PAROL Cystatin-C OS=Paralichthys olivaceus OX=8255 PE=1 SV=1
18	Q98967	5.03e-05	45.4	130	0.042	0.208	CYT_ONCKE Cystatin OS=Oncorhynchus keta OX=8018 PE=1 SV=2
19	A0A060VN46	8.62e-05	45.1	132	0.040	0.197	A0A060VN46_ONCMY Uncharacterized protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00077770001 PE=4 SV=1
20	Q91195	9.58e-05	44.7	130	0.040	0.200	CYT_ONCMY Cystatin OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06753 Bradykinin	64	14.7	Bradykinin
2	PF00666 Cathelicidins	6.3e-08	44.2	Cathelicidin
3	PF00031 Cystatin	4.5e-78	268.9	Cystatin domain
4	PF07448 Spp-24	5.4	18.6	Secreted phosphoprotein 24 (Spp-24) cystatin-like domain
5	PF16845 SQAPI	0.0046	28.6	Aspartic acid proteinase inhibitor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265023

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264690	0.999	Plasma kallikrein
2	9606.ENSP00000450482	0.998	B2 bradykinin receptor
3	9606.ENSP00000384957	0.997	Coagulation factor XI
4	9606.ENSP00000253496	0.996	Coagulation factor XII
5	9606.ENSP00000225698	0.995	Complement component 1 Q subcomponent-binding protein, mitochondrial
6	9606.ENSP00000326159	0.991	Kallikrein-4
7	9606.ENSP00000297494	0.990	Nitric oxide synthase, endothelial
8	9606.ENSP00000216629	0.989	B1 bradykinin receptor
9	9606.ENSP00000419422	0.988	Type-1 angiotensin II receptor
10	9606.ENSP00000290866	0.982	Angiotensin-converting enzyme
11	9606.ENSP00000301420	0.967	Kallikrein-1
12	9606.ENSP00000377055	0.962	Lysosomal Pro-X carboxypeptidase
13	9606.ENSP00000304467	0.943	Thimet oligopeptidase
14	9606.ENSP00000441691	0.943	Integrin alpha-M
15	9606.ENSP00000380948	0.937	Integrin beta-2
16	9606.ENSP00000272190	0.930	Renin
17	9606.ENSP00000252244	0.925	Keratin, type II cytoskeletal 1
18	9606.ENSP00000387760	0.911	Angiotensin-converting enzyme
19	9606.ENSP00000321106	0.909	Protachykinin-1
20	9606.ENSP00000307046	0.901	Syndecan-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0004869	1.000	cysteine-type endopeptidase inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.993	response to stimulus
GO:0051239	0.987	regulation of multicellular organismal process
GO:0050794	0.985	regulation of cellular process
GO:0009987	0.984	cellular process
GO:0051241	0.983	negative regulation of multicellular organismal process
GO:0048583	0.978	regulation of response to stimulus
GO:0009605	0.975	response to external stimulus
GO:0006950	0.966	response to stress
GO:0030195	0.963	negative regulation of blood coagulation
GO:0060255	0.959	regulation of macromolecule metabolic process
GO:0051171	0.957	regulation of nitrogen compound metabolic process
GO:0051246	0.945	regulation of protein metabolic process
GO:0051707	0.943	response to other organism
GO:0048523	0.939	negative regulation of cellular process
GO:0009892	0.934	negative regulation of metabolic process
GO:0051248	0.923	negative regulation of protein metabolic process
GO:0030155	0.907	regulation of cell adhesion
GO:0002376	0.899	immune system process
GO:0045861	0.898	negative regulation of proteolysis
GO:0006952	0.896	defense response
GO:0006959	0.889	humoral immune response
GO:0098542	0.868	defense response to other organism
GO:0007162	0.862	negative regulation of cell adhesion
GO:0048518	0.757	positive regulation of biological process
GO:0001906	0.610	cell killing
GO:0071704	0.482	organic substance metabolic process
GO:0061844	0.445	antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0006807	0.434	nitrogen compound metabolic process
GO:0032501	0.430	multicellular organismal process
GO:0048522	0.430	positive regulation of cellular process
GO:0007204	0.416	positive regulation of cytosolic calcium ion concentration
GO:0044238	0.406	primary metabolic process
GO:0031640	0.405	killing of cells of another organism
GO:0009893	0.382	positive regulation of metabolic process
GO:1901564	0.361	organonitrogen compound metabolic process
GO:0048584	0.359	positive regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0005615	1.000	extracellular space
GO:0016020	0.999	membrane
GO:0070013	0.996	intracellular organelle lumen
GO:0062023	0.995	collagen-containing extracellular matrix
GO:0099503	0.995	secretory vesicle
GO:0030141	0.994	secretory granule
GO:0005886	0.993	plasma membrane
GO:0005783	0.989	endoplasmic reticulum
GO:0070062	0.988	extracellular exosome
GO:0005788	0.961	endoplasmic reticulum lumen
GO:0034774	0.930	secretory granule lumen
GO:0031091	0.817	platelet alpha granule
GO:0031093	0.796	platelet alpha granule lumen
GO:0072562	0.760	blood microparticle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]