StarFunc result for job id P01100

User Input

>input (380 residues)
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF
IPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRA
QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ
TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFT
LPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA
ADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRK
GSSSNEPSSDSLSSPTLLAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P01100	0.999	0.999	3.884E-52	380	1.000	1.000	P01100.pdb.gz	FOS_HUMAN Protein c-Fos OS=Homo sapiens OX=9606 GN=FOS PE=1 SV=1
2	AFDB:H0ZPP9	0.296	0.329	2.424E-25	335	0.597	0.678	H0ZPP9.pdb.gz	H0ZPP9_TAEGU Fos proto-oncogene, AP-1 transcription factor subunit OS=Taeniopygia guttata OX=59729 GN=FOS PE=4 SV=2
3	AFDB:A2RUX8	0.307	0.336	3.361E-14	341	0.389	0.434	A2RUX8.pdb.gz	A2RUX8_DANRE FOS-like 2, AP-1 transcription factor subunit OS=Danio rerio OX=7955 GN=zgc:158347 PE=2 SV=1
4	AFDB:P15408	0.275	0.316	2.059E-13	326	0.403	0.469	P15408.pdb.gz	FOSL2_HUMAN Fos-related antigen 2 OS=Homo sapiens OX=9606 GN=FOSL2 PE=1 SV=1
5	AFDB:A0A024R0P6	0.226	0.251	2.353E-10	338	0.426	0.479	A0A024R0P6.pdb.gz
6	AFDB:G5ECG2	0.177	0.149	2.015E-2	467	0.216	0.176	G5ECG2.pdb.gz	FOS1_CAEEL Transcription factor fos-1 OS=Caenorhabditis elegans OX=6239 GN=fos-1 PE=1 SV=1
7	AFDB:Q9VW24	0.104	0.050	2.483E-2	977	0.145	0.056	Q9VW24.pdb.gz	Q9VW24_DROME Mitogen-activated protein kinase kinase kinase OS=Drosophila melanogaster OX=7227 GN=wnd PE=2 SV=1
8	AFDB:Q93XW7	0.110	0.097	2.663E-2	437	0.137	0.119	Q93XW7.pdb.gz	C3H40_ARATH Zinc finger CCCH domain-containing protein 40 OS=Arabidopsis thaliana OX=3702 GN=At3g21810 PE=1 SV=1
9	AFDB:Q4WMH0	0.173	0.111	3.282E-2	615	0.174	0.107	Q4WMH0.pdb.gz	AP1_ASPFU AP-1-like transcription factor yap1 OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=yap1 PE=3 SV=1
10	AFDB:Q388F0	0.100	0.082	5.347E-2	466	0.171	0.139	Q388F0.pdb.gz	Q388F0_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.2190 PE=4 SV=1
11	PDB:5aj0AN	0.042	0.075	7.355	203	0.021	0.039	5aj0AN.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P01100	0.0	770	380	1.000	1.000	FOS_HUMAN Protein c-Fos OS=Homo sapiens OX=9606 GN=FOS PE=1 SV=1
2	P01101	0.0	657	380	0.937	0.937	FOS_MOUSE Protein c-Fos OS=Mus musculus OX=10090 GN=Fos PE=1 SV=1
3	P12841	0.0	662	380	0.942	0.942	FOS_RAT Protein c-Fos OS=Rattus norvegicus OX=10116 GN=Fos PE=1 SV=1
4	Q6FG41	0.0	770	380	1.000	1.000	Q6FG41_HUMAN FOS protein OS=Homo sapiens OX=9606 GN=FOS PE=1 SV=1
5	H0ZPP9	1.32e-130	379	335	0.589	0.669	H0ZPP9_TAEGU Fos proto-oncogene, AP-1 transcription factor subunit OS=Taeniopygia guttata OX=59729 GN=FOS PE=4 SV=2
6	Q6P0S4	7.54e-116	342	349	0.555	0.605	Q6P0S4_DANRE Proto-oncogene c-Fos OS=Danio rerio OX=7955 GN=fos PE=2 SV=1
7	P51145	4.37e-54	183	326	0.453	0.528	FOSL2_RAT Fos-related antigen 2 OS=Rattus norvegicus OX=10116 GN=Fosl2 PE=1 SV=2
8	P15408	6.21e-54	182	326	0.442	0.515	FOSL2_HUMAN Fos-related antigen 2 OS=Homo sapiens OX=9606 GN=FOSL2 PE=1 SV=1
9	A2RUX8	3.24e-52	179	341	0.382	0.425	A2RUX8_DANRE FOS-like 2, AP-1 transcription factor subunit OS=Danio rerio OX=7955 GN=zgc:158347 PE=2 SV=1
10	P47930	1.11e-51	177	326	0.450	0.525	FOSL2_MOUSE Fos-related antigen 2 OS=Mus musculus OX=10090 GN=Fosl2 PE=1 SV=2
11	C9JCN8	5.57e-38	137	202	0.247	0.465	C9JCN8_HUMAN FOS like 2, AP-1 transcription factor subunit (Fragment) OS=Homo sapiens OX=9606 GN=FOSL2 PE=1 SV=1
12	P13346	6.28e-37	138	338	0.389	0.438	FOSB_MOUSE Protein FosB OS=Mus musculus OX=10090 GN=Fosb PE=1 SV=1
13	D3ZLB7	7.49e-37	138	338	0.387	0.435	FOSB_RAT Protein FosB OS=Rattus norvegicus OX=10116 GN=Fosb PE=1 SV=1
14	P10158	6.54e-34	129	275	0.211	0.291	FOSL1_RAT Fos-related antigen 1 OS=Rattus norvegicus OX=10116 GN=Fosl1 PE=2 SV=1
15	Q4H3J9	3.81e-33	131	501	0.311	0.236	Q4H3J9_CIOIN Transcription factor protein OS=Ciona intestinalis OX=7719 GN=Ci-Fos PE=1 SV=1
16	A0A0S2Z595	1.14e-32	125	271	0.208	0.292	A0A0S2Z595_HUMAN FOS-like antigen 1 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=FOSL1 PE=2 SV=1
17	P15407	1.14e-32	125	271	0.208	0.292	FOSL1_HUMAN Fos-related antigen 1 OS=Homo sapiens OX=9606 GN=FOSL1 PE=1 SV=1
18	P48755	9.16e-31	120	273	0.208	0.289	FOSL1_MOUSE Fos-related antigen 1 OS=Mus musculus OX=10090 GN=Fosl1 PE=1 SV=2
19	P53539	1.34e-20	94.0	338	0.126	0.142	FOSB_HUMAN Protein FosB OS=Homo sapiens OX=9606 GN=FOSB PE=1 SV=1
20	A7S4U5	4.14e-18	84.0	205	0.111	0.205	A7S4U5_NEMVE BZIP domain-containing protein OS=Nematostella vectensis OX=45351 GN=NEMVEDRAFT_v1g232694 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00170 bZIP_1	2.5e-05	35.6	bZIP transcription factor
2	PF07716 bZIP_2	0.011	27.1	Basic region leucine zipper
3	PF03131 bZIP_Maf	0.17	23.8	bZIP Maf transcription factor
4	PF11932 DUF3450	3.3e+02	12.0	Protein of unknown function (DUF3450)
5	PF02183 HALZ	5.6e+02	12.2	Homeobox associated leucine zipper
6	PF09726 Macoilin	88	13.1	Macoilin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000306245

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000239938	0.999	Early growth response protein 1
2	9606.ENSP00000252818	0.999	Transcription factor jun-D
3	9606.ENSP00000303315	0.999	Transcription factor jun-B
4	9606.ENSP00000360266	0.999	Transcription factor AP-1
5	9606.ENSP00000379330	0.999	Nuclear factor of activated T-cells, cytoplasmic 2
6	9606.ENSP00000263253	0.998	Histone acetyltransferase p300
7	9606.ENSP00000264657	0.998	Signal transducer and activator of transcription 3
8	9606.ENSP00000405330	0.998	Estrogen receptor
9	9606.ENSP00000327048	0.996	Transcription factor Maf
10	9606.ENSP00000389377	0.993	Nuclear factor of activated T-cells, cytoplasmic 1
11	9606.ENSP00000215832	0.992	Mitogen-activated protein kinase 1
12	9606.ENSP00000344456	0.992	Catenin beta-1
13	9606.ENSP00000427514	0.991	CCAAT/enhancer-binding protein alpha
14	9606.ENSP00000332973	0.990	Mothers against decapentaplegic homolog 3
15	9606.ENSP00000387699	0.990	Cyclic AMP-responsive element-binding protein 1
16	9606.ENSP00000360493	0.988	Runt-related transcription factor 2
17	9606.ENSP00000227507	0.987	G1/S-specific cyclin-D1
18	9606.ENSP00000479618	0.987	Myc proto-oncogene protein
19	9606.ENSP00000245919	0.986	Protein fosB
20	9606.ENSP00000384273	0.986	Transcription factor p65

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000981	0.997	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.996	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.978	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0042802	0.975	identical protein binding
GO:0001228	0.975	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0140297	0.836	DNA-binding transcription factor binding
GO:0061629	0.819	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0001221	0.783	transcription coregulator binding
GO:0070412	0.709	R-SMAD binding
GO:0000979	0.707	RNA polymerase II core promoter sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.999	regulation of biological process
GO:0051716	0.994	cellular response to stimulus
GO:0048518	0.987	positive regulation of biological process
GO:0080090	0.986	regulation of primary metabolic process
GO:0051171	0.986	regulation of nitrogen compound metabolic process
GO:0031323	0.986	regulation of cellular metabolic process
GO:0010468	0.985	regulation of gene expression
GO:0048522	0.984	positive regulation of cellular process
GO:0010604	0.975	positive regulation of macromolecule metabolic process
GO:0009889	0.973	regulation of biosynthetic process
GO:0019219	0.970	regulation of nucleobase-containing compound metabolic process
GO:0051173	0.962	positive regulation of nitrogen compound metabolic process
GO:0031325	0.960	positive regulation of cellular metabolic process
GO:0031326	0.957	regulation of cellular biosynthetic process
GO:0051252	0.956	regulation of RNA metabolic process
GO:0010556	0.954	regulation of macromolecule biosynthetic process
GO:2001141	0.942	regulation of RNA biosynthetic process
GO:0007154	0.938	cell communication
GO:0006355	0.932	regulation of DNA-templated transcription
GO:0008152	0.920	metabolic process
GO:0045893	0.919	positive regulation of DNA-templated transcription
GO:0006357	0.916	regulation of transcription by RNA polymerase II
GO:0006807	0.909	nitrogen compound metabolic process
GO:0071704	0.904	organic substance metabolic process
GO:0044238	0.902	primary metabolic process
GO:0042221	0.901	response to chemical
GO:0044237	0.901	cellular metabolic process
GO:0070887	0.893	cellular response to chemical stimulus
GO:0043170	0.870	macromolecule metabolic process
GO:0006950	0.858	response to stress
GO:0023052	0.827	signaling
GO:0007165	0.815	signal transduction
GO:0045944	0.762	positive regulation of transcription by RNA polymerase II
GO:0032501	0.669	multicellular organismal process
GO:0048519	0.510	negative regulation of biological process
GO:0032502	0.474	developmental process
GO:0010033	0.450	response to organic substance
GO:0048523	0.442	negative regulation of cellular process
GO:0048856	0.408	anatomical structure development
GO:0051239	0.398	regulation of multicellular organismal process
GO:1901700	0.393	response to oxygen-containing compound
GO:0009719	0.376	response to endogenous stimulus
GO:0007166	0.367	cell surface receptor signaling pathway
GO:1901360	0.363	organic cyclic compound metabolic process
GO:0034641	0.358	cellular nitrogen compound metabolic process
GO:0009605	0.352	response to external stimulus
GO:0046483	0.345	heterocycle metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.786	cytoplasm
GO:0090575	0.714	RNA polymerase II transcription regulator complex
GO:0035976	0.493	transcription factor AP-1 complex
GO:0032993	0.352	protein-DNA complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]