StarFunc result for job id P01106

User Input

>input (439 residues)
MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPD
DETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQD
LSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVL
HEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRC
HVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHN
VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLL
RKRREQLKHKLEQLRNSCA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A087WUS5	0.260	0.252	1.269E-57	454	1.000	0.967	A0A087WUS5.pdb.gz
2	AFDB:P04198	0.348	0.333	4.260E-20	464	0.390	0.369	P04198.pdb.gz	MYCN_HUMAN N-myc proto-oncogene protein OS=Homo sapiens OX=9606 GN=MYCN PE=1 SV=2
3	AFDB:P03966	0.273	0.262	1.755E-19	462	0.387	0.368	P03966.pdb.gz	MYCN_MOUSE N-myc proto-oncogene protein OS=Mus musculus OX=10090 GN=Mycn PE=2 SV=2
4	AFDB:P10166	0.228	0.267	6.894E-13	368	0.280	0.334	P10166.pdb.gz	MYCL_MOUSE Protein L-Myc OS=Mus musculus OX=10090 GN=Mycl PE=2 SV=1
5	AFDB:Q8VIP2	0.205	0.106	3.650E-3	865	0.159	0.081	Q8VIP2.pdb.gz	MLXPL_RAT Carbohydrate-responsive element-binding protein OS=Rattus norvegicus OX=10116 GN=Mlxipl PE=1 SV=1
6	AFDB:F4HRC9	0.104	0.107	1.409E-2	427	0.159	0.164	F4HRC9.pdb.gz	F4HRC9_ARATH Abscisic acid responsive elements-binding factor 2 OS=Arabidopsis thaliana OX=3702 GN=ABF2 PE=1 SV=1
7	AFDB:A0A024R5T1	0.154	0.106	1.603E-2	682	0.173	0.111	A0A024R5T1.pdb.gz
8	AFDB:Q2VPU4	0.188	0.093	2.860E-2	917	0.153	0.073	Q2VPU4.pdb.gz	MLXIP_MOUSE MLX-interacting protein OS=Mus musculus OX=10090 GN=Mlxip PE=1 SV=1
9	AFDB:Q96PD2	0.081	0.052	9.711E-2	775	0.096	0.054	Q96PD2.pdb.gz	DCBD2_HUMAN Discoidin, CUB and LCCL domain-containing protein 2 OS=Homo sapiens OX=9606 GN=DCBLD2 PE=1 SV=1
10	AFDB:F7BGG6	0.159	0.104	1.104E-1	702	0.153	0.095	F7BGG6.pdb.gz	F7BGG6_XENTR Transcription factor 12 (HTF4, helix-loop-helix transcription factors 4) OS=Xenopus tropicalis OX=8364 GN=tcf12 PE=4 SV=4
11	PDB:6bk8K	0.069	0.256	6.265	82	0.041	0.220	6bk8K.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
12	PDB:7o4i1	0.059	0.051	6.265	522	0.041	0.034	7o4i1.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
13	PDB:6lss4	0.068	0.052	6.681	620	0.046	0.032	6lss4.pdb.gz	Structural snapshots of human pre-60S ribosomal particles before and after nuclear export.
14	PDB:3ojaA	0.153	0.142	7.598	482	0.039	0.035	3ojaA.pdb.gz	A heterodimeric complex of the LRR proteins LRIM1 and APL1C regulates complement-like immunity in Anopheles gambiae.
15	PDB:7enag	0.100	0.230	8.103	166	0.048	0.127	7enag.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0B4J1R1	0.0	518	257	0.574	0.981	A0A0B4J1R1_HUMAN MYC proto-oncogene, bHLH transcription factor OS=Homo sapiens OX=9606 GN=MYC PE=1 SV=1
2	A0A494C1T8	0.0	689	339	0.772	1.000	A0A494C1T8_HUMAN Myc proto-oncogene protein OS=Homo sapiens OX=9606 GN=MYC PE=1 SV=1
3	P01106	0.0	900	439	1.000	1.000	MYC_HUMAN Myc proto-oncogene protein OS=Homo sapiens OX=9606 GN=MYC PE=1 SV=2
4	P01108	0.0	737	439	0.911	0.911	MYC_MOUSE Myc proto-oncogene protein OS=Mus musculus OX=10090 GN=Myc PE=1 SV=2
5	P09416	0.0	735	439	0.907	0.907	MYC_RAT Myc proto-oncogene protein OS=Rattus norvegicus OX=10116 GN=Myc PE=1 SV=2
6	Q28350	0.0	748	439	0.941	0.941	MYC_CANLF Myc proto-oncogene protein OS=Canis lupus familiaris OX=9615 GN=MYC PE=2 SV=2
7	P01109	1.98e-167	478	416	0.642	0.678	MYC_CHICK Myc proto-oncogene protein OS=Gallus gallus OX=9031 GN=MYC PE=1 SV=2
8	A0A060WAZ1	2.13e-141	412	406	0.583	0.631	A0A060WAZ1_ONCMY Transcriptional regulator OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00065805001 PE=4 SV=1
9	Q7ZVS9	2.62e-141	411	396	0.556	0.616	MYCB_DANRE Transcriptional regulator Myc-B OS=Danio rerio OX=7955 GN=mycb PE=2 SV=1
10	Q2L4Q4	6.14e-141	410	407	0.581	0.627	Q2L4Q4_ONCMY Transcriptional regulator OS=Oncorhynchus mykiss OX=8022 GN=myc PE=2 SV=1
11	P52160	6.06e-136	398	408	0.556	0.598	MYCA_DANRE Transcriptional regulator Myc-A OS=Danio rerio OX=7955 GN=myca PE=2 SV=3
12	P06646	3.76e-134	394	414	0.572	0.606	MYC_ONCMY Transcriptional regulator Myc (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=myc PE=3 SV=1
13	P03966	2.80e-67	223	462	0.401	0.381	MYCN_MOUSE N-myc proto-oncogene protein OS=Mus musculus OX=10090 GN=Mycn PE=2 SV=2
14	Q6P8Z1	9.08e-48	163	170	0.226	0.582	MYCB_MOUSE Protein B-Myc OS=Mus musculus OX=10090 GN=Mycb PE=1 SV=1
15	P12524	1.14e-36	139	364	0.342	0.412	MYCL_HUMAN Protein L-Myc OS=Homo sapiens OX=9606 GN=MYCL PE=1 SV=2
16	A0A1W2PPD9	5.53e-36	135	253	0.203	0.352	A0A1W2PPD9_HUMAN MYCN proto-oncogene, bHLH transcription factor OS=Homo sapiens OX=9606 GN=MYCN PE=1 SV=1
17	P04198	1.15e-35	139	464	0.205	0.194	MYCN_HUMAN N-myc proto-oncogene protein OS=Homo sapiens OX=9606 GN=MYCN PE=1 SV=2
18	P10166	6.59e-34	132	368	0.323	0.386	MYCL_MOUSE Protein L-Myc OS=Mus musculus OX=10090 GN=Mycl PE=2 SV=1
19	B2KUA9	8.74e-29	118	360	0.298	0.364	B2KUA9_DANRE Transcriptional regulator OS=Danio rerio OX=7955 GN=id:ibd5144 PE=2 SV=1
20	P12525	1.53e-20	94.7	358	0.276	0.338	MYCP1_HUMAN Putative myc-like protein MYCLP1 OS=Homo sapiens OX=9606 GN=MYCLP1 PE=5 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00010 HLH	1.1e-10	52.7	Helix-loop-helix DNA-binding domain
2	PF02344 Myc-LZ	1.5e-12	58.3	Myc leucine zipper domain
3	PF01056 Myc_N	5.4e-134	458.9	Myc amino-terminal region
4	PF05438 TRH	5	18.4	Thyrotropin-releasing hormone (TRH)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000479618

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000225916	0.999	Histone acetyltransferase KAT2A
2	9606.ENSP00000263253	0.999	Histone acetyltransferase p300
3	9606.ENSP00000274255	0.999	S-phase kinase-associated protein 2
4	9606.ENSP00000281708	0.999	F-box/WD repeat-containing protein 7
5	9606.ENSP00000316779	0.999	Myc box-dependent-interacting protein 1
6	9606.ENSP00000329357	0.999	Transcription factor Sp1
7	9606.ENSP00000340330	0.999	Histone acetyltransferase KAT5
8	9606.ENSP00000351490	0.999	Protein max
9	9606.ENSP00000352925	0.999	Transformation/transcription domain-associated protein
10	9606.ENSP00000364885	0.999	Zinc finger and BTB domain-containing protein 17
11	9606.ENSP00000418915	0.999	Cyclin-dependent kinase inhibitor 2A
12	9606.ENSP00000262160	0.998	Mothers against decapentaplegic homolog 2
13	9606.ENSP00000264709	0.998	DNA (cytosine-5)-methyltransferase 3A
14	9606.ENSP00000302967	0.998	Histone deacetylase 3
15	9606.ENSP00000418960	0.998	Breast cancer type 1 susceptibility protein
16	9606.ENSP00000437955	0.998	Hypoxia-inducible factor 1-alpha
17	9606.ENSP00000473172	0.998	RuvB-like 2
18	9606.ENSP00000263754	0.997	Histone acetyltransferase KAT2B
19	9606.ENSP00000447942	0.997	Prefoldin subunit 5
20	9606.ENSP00000318297	0.996	RuvB-like 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1990837	0.997	sequence-specific double-stranded DNA binding
GO:0000987	0.989	cis-regulatory region sequence-specific DNA binding
GO:0000977	0.986	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0003700	0.980	DNA-binding transcription factor activity
GO:0000978	0.976	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000981	0.746	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001228	0.659	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0019899	0.624	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048522	0.993	positive regulation of cellular process
GO:0050896	0.992	response to stimulus
GO:0048523	0.992	negative regulation of cellular process
GO:0009987	0.989	cellular process
GO:0042221	0.982	response to chemical
GO:0060255	0.971	regulation of macromolecule metabolic process
GO:0010941	0.960	regulation of cell death
GO:0048583	0.957	regulation of response to stimulus
GO:0080090	0.946	regulation of primary metabolic process
GO:0051171	0.942	regulation of nitrogen compound metabolic process
GO:0031323	0.941	regulation of cellular metabolic process
GO:0010468	0.932	regulation of gene expression
GO:0009893	0.903	positive regulation of metabolic process
GO:0019219	0.890	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.886	regulation of macromolecule biosynthetic process
GO:0031326	0.886	regulation of cellular biosynthetic process
GO:0006355	0.876	regulation of DNA-templated transcription
GO:0042127	0.867	regulation of cell population proliferation
GO:0051716	0.819	cellular response to stimulus
GO:0010604	0.790	positive regulation of macromolecule metabolic process
GO:0051173	0.778	positive regulation of nitrogen compound metabolic process
GO:0031325	0.767	positive regulation of cellular metabolic process
GO:0006357	0.739	regulation of transcription by RNA polymerase II
GO:0009892	0.733	negative regulation of metabolic process
GO:0010646	0.700	regulation of cell communication
GO:0008152	0.683	metabolic process
GO:0045935	0.676	positive regulation of nucleobase-containing compound metabolic process
GO:0009891	0.670	positive regulation of biosynthetic process
GO:0031328	0.660	positive regulation of cellular biosynthetic process
GO:0010557	0.658	positive regulation of macromolecule biosynthetic process
GO:0051254	0.643	positive regulation of RNA metabolic process
GO:1903508	0.595	positive regulation of nucleic acid-templated transcription
GO:0045893	0.594	positive regulation of DNA-templated transcription
GO:0010605	0.583	negative regulation of macromolecule metabolic process
GO:0032502	0.580	developmental process
GO:0071704	0.580	organic substance metabolic process
GO:0009410	0.579	response to xenobiotic stimulus
GO:0048856	0.556	anatomical structure development
GO:0070887	0.539	cellular response to chemical stimulus
GO:0043067	0.527	regulation of programmed cell death
GO:0042981	0.524	regulation of apoptotic process
GO:0031324	0.515	negative regulation of cellular metabolic process
GO:0044237	0.504	cellular metabolic process
GO:0023051	0.502	regulation of signaling
GO:0044238	0.500	primary metabolic process
GO:0009966	0.494	regulation of signal transduction
GO:0007165	0.489	signal transduction
GO:0065009	0.487	regulation of molecular function
GO:0006807	0.484	nitrogen compound metabolic process
GO:0051239	0.483	regulation of multicellular organismal process
GO:0008284	0.482	positive regulation of cell population proliferation
GO:0006950	0.452	response to stress
GO:0051172	0.450	negative regulation of nitrogen compound metabolic process
GO:0043170	0.440	macromolecule metabolic process
GO:0045944	0.378	positive regulation of transcription by RNA polymerase II
GO:0050793	0.369	regulation of developmental process
GO:0032501	0.361	multicellular organismal process
GO:0044093	0.360	positive regulation of molecular function
GO:0050678	0.354	regulation of epithelial cell proliferation
GO:0071840	0.331	cellular component organization or biogenesis
GO:0009890	0.315	negative regulation of biosynthetic process
GO:0045934	0.315	negative regulation of nucleobase-containing compound metabolic process
GO:0031327	0.314	negative regulation of cellular biosynthetic process
GO:0010558	0.312	negative regulation of macromolecule biosynthetic process
GO:0051246	0.307	regulation of protein metabolic process
GO:0000122	0.304	negative regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.813	cytoplasm
GO:0005829	0.396	cytosol
GO:0043232	0.379	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]