StarFunc result for job id P01111

User Input

>input (189 residues)
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P01111	1.000	1.000	6.004E-41	189	1.000	1.000	P01111.pdb.gz	RASN_HUMAN GTPase NRas OS=Homo sapiens OX=9606 GN=NRAS PE=1 SV=1
2	AFDB:P01112	0.918	0.918	2.506E-35	189	0.852	0.852	P01112.pdb.gz	RASH_HUMAN GTPase HRas OS=Homo sapiens OX=9606 GN=HRAS PE=1 SV=1
3	AFDB:A0A060XMH4	0.947	0.947	1.908E-34	189	0.878	0.878	A0A060XMH4.pdb.gz	A0A060XMH4_ONCMY V-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00021867001 PE=3 SV=1
4	PDB:6zizA	0.888	0.987	1.330E-33	170	0.884	0.982	6zizA.pdb.gz	Drugging all RAS isoforms with one pocket.
5	AFDB:P22981	0.929	0.954	1.364E-33	184	0.735	0.755	P22981.pdb.gz	LET60_CAEEL Ras protein let-60 OS=Caenorhabditis elegans OX=6239 GN=let-60 PE=1 SV=1
6	AFDB:P08646	0.953	0.953	3.532E-33	189	0.757	0.757	P08646.pdb.gz	RAS1_DROME Ras-like protein 1 OS=Drosophila melanogaster OX=7227 GN=Ras85D PE=1 SV=2
7	AFDB:Q6AZA4	0.920	0.924	9.147E-33	188	0.799	0.803	Q6AZA4.pdb.gz	Q6AZA4_DANRE GTPase KRas OS=Danio rerio OX=7955 GN=K-ras PE=1 SV=1
8	AFDB:P03967	0.970	0.980	1.233E-31	187	0.646	0.652	P03967.pdb.gz	RASD_DICDI Ras-like protein rasD OS=Dictyostelium discoideum OX=44689 GN=rasD PE=1 SV=2
9	AFDB:P15064	0.876	0.876	2.048E-31	189	0.688	0.688	P15064.pdb.gz	RASG_DICDI Ras-like protein rasG OS=Dictyostelium discoideum OX=44689 GN=rasG PE=1 SV=1
10	AFDB:P01120	0.870	0.515	1.631E-29	322	0.582	0.342	P01120.pdb.gz	RAS2_YEAST Ras-like protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAS2 PE=1 SV=4
11	AFDB:P0CY32	0.937	0.612	2.709E-29	290	0.614	0.400	P0CY32.pdb.gz	RAS1_CANAX Ras-like protein 1 OS=Candida albicans OX=5476 GN=RAS1 PE=3 SV=1
12	PDB:7kyzA	0.813	0.817	7.623E-28	188	0.852	0.856	7kyzA.pdb.gz
13	PDB:6kykC	0.849	0.947	1.074E-25	169	0.503	0.562	6kykC.pdb.gz	Shank3 Binds to and Stabilizes the Active Form of Rap1 and HRas GTPases via Its NTD-ANK Tandem with Distinct Mechanisms.
14	PDB:7sd0B	0.852	0.924	8.029E-24	174	0.487	0.529	7sd0B.pdb.gz	Structural basis for SHOC2 modulation of RAS signalling.
15	PDB:2bovA	0.860	0.937	9.532E-23	173	0.476	0.520	2bovA.pdb.gz	Molecular Recognition of an Adp-Ribosylating Clostridium Botulinum C3 Exoenzyme by Rala Gtpase
16	PDB:6zqtA	0.864	0.942	1.687E-22	173	0.460	0.503	6zqtA.pdb.gz	Affinity maturation of the RLIP76 Ral binding domain to inform the design of stapled peptides targeting the Ral GTPases.
17	PDB:1kaoA	0.839	0.946	1.042E-20	167	0.429	0.485	1kaoA.pdb.gz	Crystal structures of the small G protein Rap2A in complex with its substrate GTP, with GDP and with GTPgammaS.
18	PDB:2gf0B	0.781	0.844	5.673E-19	174	0.333	0.362	2gf0B.pdb.gz	The crystal structure of the human DiRas1 GTPase in the inactive GDP bound state
19	PDB:2zetA	0.849	0.885	1.070E-18	181	0.328	0.343	2zetA.pdb.gz	Structural basis for the exclusive specificity of Slac2-a/melanophilin for the Rab27 GTPases.
20	PDB:7e1tB	0.856	0.928	1.379E-18	174	0.270	0.293	7e1tB.pdb.gz	Nde1 is a Rab9 effector for loading late endosomes to cytoplasmic dynein motor complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P01111	3.65e-141	392	189	1.000	1.000	RASN_HUMAN GTPase NRas OS=Homo sapiens OX=9606 GN=NRAS PE=1 SV=1
2	Q04970	1.50e-140	391	189	0.995	0.995	RASN_RAT GTPase NRas OS=Rattus norvegicus OX=10116 GN=Nras PE=1 SV=1
3	P08556	3.43e-139	387	189	0.984	0.984	RASN_MOUSE GTPase NRas OS=Mus musculus OX=10090 GN=Nras PE=1 SV=1
4	P08644	1.83e-113	322	189	0.884	0.884	RASK_RAT GTPase KRas OS=Rattus norvegicus OX=10116 GN=Kras PE=1 SV=3
5	P32883	1.83e-113	322	189	0.884	0.884	RASK_MOUSE GTPase KRas OS=Mus musculus OX=10090 GN=Kras PE=1 SV=1
6	P01116	1.66e-112	320	189	0.873	0.873	RASK_HUMAN GTPase KRas OS=Homo sapiens OX=9606 GN=KRAS PE=1 SV=1
7	P01112	4.65e-112	319	189	0.852	0.852	RASH_HUMAN GTPase HRas OS=Homo sapiens OX=9606 GN=HRAS PE=1 SV=1
8	P20171	4.65e-112	319	189	0.852	0.852	RASH_RAT GTPase HRas OS=Rattus norvegicus OX=10116 GN=Hras PE=1 SV=2
9	Q61411	4.65e-112	319	189	0.852	0.852	RASH_MOUSE GTPase HRas OS=Mus musculus OX=10090 GN=Hras PE=1 SV=2
10	X5D945	4.65e-112	319	189	0.852	0.852	X5D945_HUMAN Harvey rat sarcoma viral oncoprotein isoform A (Fragment) OS=Homo sapiens OX=9606 GN=HRAS PE=2 SV=1
11	A0A060XMH4	4.31e-111	316	189	0.878	0.878	A0A060XMH4_ONCMY V-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00021867001 PE=3 SV=1
12	A0A2R8Q8S1	1.32e-108	310	189	0.852	0.852	A0A2R8Q8S1_DANRE GTPase KRas isoform X1 OS=Danio rerio OX=7955 GN=wu:fa04e08 PE=1 SV=1
13	Q6AZA4	5.77e-102	293	188	0.794	0.798	Q6AZA4_DANRE GTPase KRas OS=Danio rerio OX=7955 GN=K-ras PE=1 SV=1
14	P08646	1.59e-94	275	189	0.746	0.746	RAS1_DROME Ras-like protein 1 OS=Drosophila melanogaster OX=7227 GN=Ras85D PE=1 SV=2
15	P22981	1.59e-93	272	184	0.735	0.755	LET60_CAEEL Ras protein let-60 OS=Caenorhabditis elegans OX=6239 GN=let-60 PE=1 SV=1
16	P15064	1.03e-82	244	189	0.661	0.661	RASG_DICDI Ras-like protein rasG OS=Dictyostelium discoideum OX=44689 GN=rasG PE=1 SV=1
17	P03967	4.47e-79	235	187	0.635	0.642	RASD_DICDI Ras-like protein rasD OS=Dictyostelium discoideum OX=44689 GN=rasD PE=1 SV=2
18	P32253	8.92e-73	219	189	0.582	0.582	RASC_DICDI Ras-like protein rasC OS=Dictyostelium discoideum OX=44689 GN=rasC PE=1 SV=1
19	P32252	2.56e-71	216	197	0.608	0.584	RASB_DICDI Ras-like protein rasB OS=Dictyostelium discoideum OX=44689 GN=rasB PE=1 SV=1
20	Q12526	3.73e-71	216	212	0.619	0.552	RAS_EMENI Ras-like protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=rasA PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00025 Arf	2.2e-05	35.5	ADP-ribosylation factor family
2	PF09848 DUF2075	4.2e+02	11.6	Schlafen group 3, DNA/RNA helicase domain
3	PF02421 FeoB_N	5	18.1	Ferrous iron transport protein B
4	PF00503 G-alpha	3.8e+02	11.6	G-protein alpha subunit
5	PF00009 GTP_EFTU	0.0054	27.8	Elongation factor Tu GTP binding domain
6	PF00056 Ldh_1_N	4.9e+02	12.2	lactate/malate dehydrogenase, NAD binding domain
7	PF01926 MMR_HSR1	0.17	23.4	50S ribosome-binding GTPase
8	PF10609 ParA	4.2e+02	11.7	NUBPL iron-transfer P-loop NTPase
9	PF00071 Ras	2.8e-54	194.6	Ras family
10	PF08477 Roc	2.9e-17	74.4	Ras of Complex, Roc, domain of DAPkinase
11	PF03193 RsgA_GTPase	0.015	26.7	RsgA GTPase
12	PF00735 Septin	1.7e+02	12.9	Septin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008832227.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008821740.1	0.992	Serine/threonine-protein kinase B-raf isoform X1
2	1026970.XP_008853131.1	0.990	RAF proto-oncogene serine/threonine-protein kinase isoform X1
3	1026970.XP_008819832.1	0.984	Neurofibromin isoform X1
4	1026970.XP_008836896.1	0.980	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
5	1026970.XP_008837642.1	0.980	Ras GTPase-activating protein 1
6	1026970.XP_008852607.1	0.978	HRas proto-oncogene, GTPase
7	1026970.XP_008834447.1	0.977	GTPase KRas
8	1026970.XP_008834567.1	0.977	Mitogen-activated protein kinase kinase 1
9	1026970.XP_008843731.1	0.976	SOS Ras/Rac guanine nucleotide exchange factor 1
10	1026970.XP_008822143.1	0.975	Mitogen-activated protein kinase 3
11	1026970.XP_008842162.1	0.975	Ral guanine nucleotide dissociation stimulator isoform X1
12	1026970.XP_008840426.1	0.974	Mitogen-activated protein kinase 1
13	1026970.XP_008840738.1	0.974	A-Raf proto-oncogene, serine/threonine kinase
14	1026970.XP_008831541.1	0.972	KIT proto-oncogene receptor tyrosine kinase
15	1026970.XP_008822511.1	0.971	Ral guanine nucleotide dissociation stimulator-like 1 isoform X1
16	1026970.XP_008835302.1	0.970	Mitogen-activated protein kinase kinase 2
17	1026970.XP_008826093.1	0.969	Afadin, adherens junction formation factor
18	1026970.XP_008828076.1	0.968	SOS Ras/Rho guanine nucleotide exchange factor 2
19	1026970.XP_008828950.1	0.966	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
20	1026970.XP_008844034.1	0.964	SHOC2, leucine rich repeat scaffold protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003924	0.999	GTPase activity
GO:1901363	0.940	heterocyclic compound binding
GO:0097159	0.936	organic cyclic compound binding
GO:0019001	0.930	guanyl nucleotide binding
GO:0097367	0.922	carbohydrate derivative binding
GO:0032561	0.914	guanyl ribonucleotide binding
GO:0043168	0.904	anion binding
GO:0005525	0.875	GTP binding
GO:0044877	0.708	protein-containing complex binding
GO:0098772	0.683	molecular function regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0051716	0.987	cellular response to stimulus
GO:0007154	0.985	cell communication
GO:0023052	0.984	signaling
GO:0048518	0.964	positive regulation of biological process
GO:0007165	0.951	signal transduction
GO:0032502	0.908	developmental process
GO:0042127	0.881	regulation of cell population proliferation
GO:0019222	0.874	regulation of metabolic process
GO:0048583	0.866	regulation of response to stimulus
GO:0048856	0.862	anatomical structure development
GO:0080090	0.852	regulation of primary metabolic process
GO:0060255	0.811	regulation of macromolecule metabolic process
GO:0035556	0.809	intracellular signal transduction
GO:0048522	0.801	positive regulation of cellular process
GO:0010604	0.795	positive regulation of macromolecule metabolic process
GO:0007264	0.792	small GTPase mediated signal transduction
GO:0051171	0.774	regulation of nitrogen compound metabolic process
GO:0008284	0.758	positive regulation of cell population proliferation
GO:0007265	0.741	Ras protein signal transduction
GO:0031323	0.698	regulation of cellular metabolic process
GO:0000165	0.679	MAPK cascade
GO:0030154	0.666	cell differentiation
GO:0061061	0.655	muscle structure development
GO:0010646	0.560	regulation of cell communication
GO:0023051	0.559	regulation of signaling
GO:0009966	0.547	regulation of signal transduction
GO:0051246	0.500	regulation of protein metabolic process
GO:0010468	0.473	regulation of gene expression
GO:0032501	0.461	multicellular organismal process
GO:0031325	0.449	positive regulation of cellular metabolic process
GO:0044237	0.425	cellular metabolic process
GO:0048519	0.424	negative regulation of biological process
GO:0048513	0.399	animal organ development
GO:0048584	0.381	positive regulation of response to stimulus
GO:0065009	0.373	regulation of molecular function
GO:0050678	0.352	regulation of epithelial cell proliferation
GO:0048523	0.348	negative regulation of cellular process
GO:0051173	0.345	positive regulation of nitrogen compound metabolic process
GO:0042221	0.335	response to chemical
GO:0007166	0.335	cell surface receptor signaling pathway
GO:1902531	0.333	regulation of intracellular signal transduction
GO:0045445	0.311	myoblast differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.999	cell periphery
GO:0016020	0.999	membrane
GO:0005886	0.990	plasma membrane
GO:0005622	0.975	intracellular anatomical structure
GO:0043226	0.935	organelle
GO:0043227	0.925	membrane-bounded organelle
GO:0005737	0.897	cytoplasm
GO:0043229	0.853	intracellular organelle
GO:0043231	0.778	intracellular membrane-bounded organelle
GO:0005829	0.732	cytosol
GO:0012505	0.470	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19669	0.999	GTP + H2O = GDP + H(+) + phosphate

[back to server]