StarFunc result for job id P01116

User Input

>input (189 residues)
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC
VKIKKCIIM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A060XMH4	0.967	0.967	2.487E-36	189	0.963	0.963	A0A060XMH4.pdb.gz	A0A060XMH4_ONCMY V-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00021867001 PE=3 SV=1
2	AFDB:P01111	0.944	0.944	5.618E-36	189	0.873	0.873	P01111.pdb.gz	RASN_HUMAN GTPase NRas OS=Homo sapiens OX=9606 GN=NRAS PE=1 SV=1
3	AFDB:P01112	0.916	0.916	5.458E-34	189	0.868	0.868	P01112.pdb.gz	RASH_HUMAN GTPase HRas OS=Homo sapiens OX=9606 GN=HRAS PE=1 SV=1
4	AFDB:P22981	0.910	0.934	1.254E-32	184	0.751	0.772	P22981.pdb.gz	LET60_CAEEL Ras protein let-60 OS=Caenorhabditis elegans OX=6239 GN=let-60 PE=1 SV=1
5	AFDB:Q6AZA4	0.902	0.907	1.611E-32	188	0.862	0.867	Q6AZA4.pdb.gz	Q6AZA4_DANRE GTPase KRas OS=Danio rerio OX=7955 GN=K-ras PE=1 SV=1
6	AFDB:P08646	0.936	0.936	6.812E-32	189	0.767	0.767	P08646.pdb.gz	RAS1_DROME Ras-like protein 1 OS=Drosophila melanogaster OX=7227 GN=Ras85D PE=1 SV=2
7	PDB:6zizA	0.889	0.988	7.952E-32	170	0.825	0.918	6zizA.pdb.gz	Drugging all RAS isoforms with one pocket.
8	AFDB:P15064	0.890	0.890	9.478E-31	189	0.704	0.704	P15064.pdb.gz	RASG_DICDI Ras-like protein rasG OS=Dictyostelium discoideum OX=44689 GN=rasG PE=1 SV=1
9	AFDB:P03967	0.930	0.940	1.297E-30	187	0.651	0.658	P03967.pdb.gz	RASD_DICDI Ras-like protein rasD OS=Dictyostelium discoideum OX=44689 GN=rasD PE=1 SV=2
10	AFDB:P0CY32	0.925	0.604	3.226E-28	290	0.603	0.393	P0CY32.pdb.gz	RAS1_CANAX Ras-like protein 1 OS=Candida albicans OX=5476 GN=RAS1 PE=3 SV=1
11	AFDB:P01120	0.879	0.521	3.893E-28	322	0.566	0.332	P01120.pdb.gz	RAS2_YEAST Ras-like protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAS2 PE=1 SV=4
12	PDB:7kyzA	0.820	0.824	1.239E-27	188	0.899	0.904	7kyzA.pdb.gz
13	PDB:6kykC	0.849	0.948	3.281E-25	169	0.508	0.568	6kykC.pdb.gz	Shank3 Binds to and Stabilizes the Active Form of Rap1 and HRas GTPases via Its NTD-ANK Tandem with Distinct Mechanisms.
14	PDB:7sd0B	0.853	0.925	2.812E-23	174	0.492	0.534	7sd0B.pdb.gz	Structural basis for SHOC2 modulation of RAS signalling.
15	PDB:6zqtA	0.865	0.943	6.877E-22	173	0.450	0.491	6zqtA.pdb.gz	Affinity maturation of the RLIP76 Ral binding domain to inform the design of stapled peptides targeting the Ral GTPases.
16	PDB:2bovA	0.862	0.939	1.136E-21	173	0.471	0.514	2bovA.pdb.gz	Molecular Recognition of an Adp-Ribosylating Clostridium Botulinum C3 Exoenzyme by Rala Gtpase
17	PDB:1kaoA	0.839	0.946	2.030E-20	167	0.434	0.491	1kaoA.pdb.gz	Crystal structures of the small G protein Rap2A in complex with its substrate GTP, with GDP and with GTPgammaS.
18	PDB:2gf0B	0.782	0.846	6.794E-19	174	0.349	0.379	2gf0B.pdb.gz	The crystal structure of the human DiRas1 GTPase in the inactive GDP bound state
19	PDB:7e1tB	0.830	0.898	1.122E-18	174	0.286	0.310	7e1tB.pdb.gz	Nde1 is a Rab9 effector for loading late endosomes to cytoplasmic dynein motor complex.
20	PDB:5szjA	0.839	0.904	1.535E-18	175	0.323	0.349	5szjA.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P01116	1.64e-140	390	189	1.000	1.000	RASK_HUMAN GTPase KRas OS=Homo sapiens OX=9606 GN=KRAS PE=1 SV=1
2	P08644	1.06e-139	389	189	0.989	0.989	RASK_RAT GTPase KRas OS=Rattus norvegicus OX=10116 GN=Kras PE=1 SV=3
3	P32883	1.06e-139	389	189	0.989	0.989	RASK_MOUSE GTPase KRas OS=Mus musculus OX=10090 GN=Kras PE=1 SV=1
4	A0A060XMH4	1.79e-136	380	189	0.963	0.963	A0A060XMH4_ONCMY V-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00021867001 PE=3 SV=1
5	A0A2R8Q8S1	3.04e-124	350	189	0.931	0.931	A0A2R8Q8S1_DANRE GTPase KRas isoform X1 OS=Danio rerio OX=7955 GN=wu:fa04e08 PE=1 SV=1
6	Q04970	3.70e-112	319	189	0.878	0.878	RASN_RAT GTPase NRas OS=Rattus norvegicus OX=10116 GN=Nras PE=1 SV=1
7	P01111	1.21e-111	318	189	0.873	0.873	RASN_HUMAN GTPase NRas OS=Homo sapiens OX=9606 GN=NRAS PE=1 SV=1
8	P01112	1.52e-111	317	189	0.868	0.868	RASH_HUMAN GTPase HRas OS=Homo sapiens OX=9606 GN=HRAS PE=1 SV=1
9	P20171	1.52e-111	317	189	0.868	0.868	RASH_RAT GTPase HRas OS=Rattus norvegicus OX=10116 GN=Hras PE=1 SV=2
10	Q61411	1.52e-111	317	189	0.868	0.868	RASH_MOUSE GTPase HRas OS=Mus musculus OX=10090 GN=Hras PE=1 SV=2
11	X5D945	1.52e-111	317	189	0.868	0.868	X5D945_HUMAN Harvey rat sarcoma viral oncoprotein isoform A (Fragment) OS=Homo sapiens OX=9606 GN=HRAS PE=2 SV=1
12	P08556	1.70e-111	317	189	0.878	0.878	RASN_MOUSE GTPase NRas OS=Mus musculus OX=10090 GN=Nras PE=1 SV=1
13	Q6AZA4	1.97e-107	307	188	0.836	0.840	Q6AZA4_DANRE GTPase KRas OS=Danio rerio OX=7955 GN=K-ras PE=1 SV=1
14	P08646	9.78e-94	272	189	0.746	0.746	RAS1_DROME Ras-like protein 1 OS=Drosophila melanogaster OX=7227 GN=Ras85D PE=1 SV=2
15	P22981	4.40e-92	268	184	0.746	0.766	LET60_CAEEL Ras protein let-60 OS=Caenorhabditis elegans OX=6239 GN=let-60 PE=1 SV=1
16	P15064	7.36e-86	253	189	0.709	0.709	RASG_DICDI Ras-like protein rasG OS=Dictyostelium discoideum OX=44689 GN=rasG PE=1 SV=1
17	P03967	4.62e-79	235	187	0.656	0.663	RASD_DICDI Ras-like protein rasD OS=Dictyostelium discoideum OX=44689 GN=rasD PE=1 SV=2
18	P32253	7.79e-74	222	189	0.587	0.587	RASC_DICDI Ras-like protein rasC OS=Dictyostelium discoideum OX=44689 GN=rasC PE=1 SV=1
19	P32254	9.82e-71	214	194	0.571	0.557	RASS_DICDI Ras-like protein rasS OS=Dictyostelium discoideum OX=44689 GN=rasS PE=2 SV=1
20	Q12526	6.74e-70	213	212	0.603	0.538	RAS_EMENI Ras-like protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=rasA PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13481 AAA_25	7e+02	11.2	AAA domain
2	PF00025 Arf	2.1e-05	35.5	ADP-ribosylation factor family
3	PF03029 ATP_bind_1	42	15.4	Conserved hypothetical ATP binding protein
4	PF01656 CbiA	6e+02	11.9	CobQ/CobB/MinD/ParA nucleotide binding domain
5	PF02421 FeoB_N	33	15.4	Ferrous iron transport protein B
6	PF00503 G-alpha	17	16.1	G-protein alpha subunit
7	PF00009 GTP_EFTU	0.0022	29.1	Elongation factor Tu GTP binding domain
8	PF04670 Gtr1_RagA	50	14.7	Gtr1/RagA G protein conserved region
9	PF01926 MMR_HSR1	0.054	25.0	50S ribosome-binding GTPase
10	PF00071 Ras	4.4e-55	197.2	Ras family
11	PF08477 Roc	5.3e-18	76.8	Ras of Complex, Roc, domain of DAPkinase
12	PF03193 RsgA_GTPase	0.014	26.7	RsgA GTPase
13	PF00735 Septin	92	13.8	Septin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000006371

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000005755	0.997	Raf-1 proto-oncogene, serine/threonine kinase
2	61853.ENSNLEP00000013316	0.996	Neurofibromin 1
3	61853.ENSNLEP00000024052	0.992	B-Raf proto-oncogene, serine/threonine kinase
4	61853.ENSNLEP00000016465	0.991	RAS p21 protein activator (GTPase activating protein) 1
5	61853.ENSNLEP00000010419	0.990	Receptor protein-tyrosine kinase
6	61853.ENSNLEP00000006936	0.989	Phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit alpha
7	61853.ENSNLEP00000019976	0.988	SOS Ras/Rac guanine nucleotide exchange factor 1
8	61853.ENSNLEP00000010775	0.987	Phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit gamma
9	61853.ENSNLEP00000015840	0.987	Ral guanine nucleotide dissociation stimulator
10	61853.ENSNLEP00000010109	0.985	HRas proto-oncogene, GTPase
11	61853.ENSNLEP00000018949	0.982	SHOC2, leucine rich repeat scaffold protein
12	61853.ENSNLEP00000000288	0.981	Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. MAP kinase subfamily
13	61853.ENSNLEP00000007631	0.981	Tyrosine-protein kinase
14	61853.ENSNLEP00000004277	0.978	T-cell lymphoma invasion and metastasis 1
15	61853.ENSNLEP00000005291	0.973	Phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit beta
16	61853.ENSNLEP00000015688	0.973	Belongs to the protein kinase superfamily.
17	61853.ENSNLEP00000007365	0.972	Ras and Rab interactor 1
18	61853.ENSNLEP00000013970	0.972	RAS guanyl releasing protein 1 (calcium and DAG-regulated)
19	61853.ENSNLEP00000014740	0.972	SOS Ras/Rho guanine nucleotide exchange factor 2
20	61853.ENSNLEP00000021896	0.971	annotation not available

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0044877	0.998	protein-containing complex binding
GO:0003924	0.998	GTPase activity
GO:0098772	0.997	molecular function regulator activity
GO:0097159	0.955	organic cyclic compound binding
GO:1901363	0.954	heterocyclic compound binding
GO:0097367	0.940	carbohydrate derivative binding
GO:0019001	0.936	guanyl nucleotide binding
GO:0043168	0.932	anion binding
GO:0032561	0.932	guanyl ribonucleotide binding
GO:0035639	0.909	purine ribonucleoside triphosphate binding
GO:0005525	0.904	GTP binding
GO:0030234	0.712	enzyme regulator activity
GO:0019207	0.542	kinase regulator activity
GO:0019899	0.443	enzyme binding
GO:0019003	0.437	GDP binding
GO:0140677	0.370	molecular function activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050794	0.988	regulation of cellular process
GO:0050896	0.985	response to stimulus
GO:0051716	0.979	cellular response to stimulus
GO:0007154	0.977	cell communication
GO:0019222	0.977	regulation of metabolic process
GO:0060255	0.972	regulation of macromolecule metabolic process
GO:0023052	0.961	signaling
GO:0048518	0.956	positive regulation of biological process
GO:0032502	0.955	developmental process
GO:0048856	0.948	anatomical structure development
GO:0007165	0.936	signal transduction
GO:0032501	0.862	multicellular organismal process
GO:0001932	0.832	regulation of protein phosphorylation
GO:0042127	0.818	regulation of cell population proliferation
GO:0048522	0.794	positive regulation of cellular process
GO:0035556	0.790	intracellular signal transduction
GO:0048583	0.783	regulation of response to stimulus
GO:0007275	0.776	multicellular organism development
GO:1902533	0.770	positive regulation of intracellular signal transduction
GO:0009893	0.759	positive regulation of metabolic process
GO:0008284	0.756	positive regulation of cell population proliferation
GO:0010468	0.753	regulation of gene expression
GO:0051173	0.748	positive regulation of nitrogen compound metabolic process
GO:0010604	0.744	positive regulation of macromolecule metabolic process
GO:0000165	0.738	MAPK cascade
GO:0031325	0.728	positive regulation of cellular metabolic process
GO:0048731	0.678	system development
GO:0009653	0.656	anatomical structure morphogenesis
GO:0030154	0.656	cell differentiation
GO:0048519	0.632	negative regulation of biological process
GO:0048513	0.619	animal organ development
GO:0045937	0.617	positive regulation of phosphate metabolic process
GO:0048568	0.591	embryonic organ development
GO:0072359	0.553	circulatory system development
GO:0065009	0.542	regulation of molecular function
GO:0051247	0.456	positive regulation of protein metabolic process
GO:0009887	0.443	animal organ morphogenesis
GO:0048523	0.413	negative regulation of cellular process
GO:0008152	0.370	metabolic process
GO:0043410	0.367	positive regulation of MAPK cascade
GO:0044237	0.356	cellular metabolic process
GO:0031401	0.337	positive regulation of protein modification process
GO:0042221	0.336	response to chemical
GO:0001934	0.319	positive regulation of protein phosphorylation
GO:0007166	0.318	cell surface receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	1.000	cell periphery
GO:0016020	1.000	membrane
GO:0005886	0.990	plasma membrane
GO:0005622	0.973	intracellular anatomical structure
GO:0043226	0.938	organelle
GO:0043227	0.926	membrane-bounded organelle
GO:0005737	0.902	cytoplasm
GO:0043229	0.875	intracellular organelle
GO:0043231	0.839	intracellular membrane-bounded organelle
GO:0012505	0.421	endomembrane system
GO:0005829	0.410	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19669	0.998	GTP + H2O = GDP + H(+) + phosphate

[back to server]