StarFunc result for job id P01127

User Input

>input (241 residues)
MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAEL
DLNMTRSHSGGELESLARGRRSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLV
WPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKC
ETVAAARPVTRSPGGSQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLG
A

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B1H0W5	0.701	0.701	3.846E-34	241	0.909	0.909	B1H0W5.pdb.gz	B1H0W5_BOVIN PDGFB protein OS=Bos taurus OX=9913 GN=PDGFB PE=2 SV=1
2	AFDB:P31240	0.633	0.633	3.509E-32	241	0.892	0.892	P31240.pdb.gz	PDGFB_MOUSE Platelet-derived growth factor subunit B OS=Mus musculus OX=10090 GN=Pdgfb PE=2 SV=1
3	AFDB:P04085	0.563	0.637	3.172E-17	211	0.357	0.408	P04085.pdb.gz	PDGFA_HUMAN Platelet-derived growth factor subunit A OS=Homo sapiens OX=9606 GN=PDGFA PE=1 SV=1
4	AFDB:E7FBB3	0.565	0.295	4.431E-17	482	0.336	0.168	E7FBB3.pdb.gz
5	AFDB:A0A2R8PYF1	0.488	0.281	5.145E-16	463	0.328	0.171	A0A2R8PYF1.pdb.gz
6	AFDB:Q90WK1	0.560	0.686	1.004E-15	194	0.340	0.423	Q90WK1.pdb.gz	Q90WK1_CHICK Platelet derived growth factor subunit A OS=Gallus gallus OX=9031 GN=PDGF-A (S2) PE=2 SV=1
7	AFDB:Q9DE50	0.571	0.697	3.236E-15	195	0.328	0.405	Q9DE50.pdb.gz
8	AFDB:Q208T6	0.394	0.355	1.285E-7	272	0.228	0.202	Q208T6.pdb.gz	Q208T6_DANRE C-fos induced growth factor OS=Danio rerio OX=7955 GN=figf PE=2 SV=1
9	AFDB:P49765	0.308	0.355	8.548E-7	207	0.141	0.164	P49765.pdb.gz	VEGFB_HUMAN Vascular endothelial growth factor B OS=Homo sapiens OX=9606 GN=VEGFB PE=1 SV=2
10	AFDB:O35485	0.313	0.361	1.492E-6	207	0.124	0.145	O35485.pdb.gz	VEGFB_RAT Vascular endothelial growth factor B OS=Rattus norvegicus OX=10116 GN=Vegfb PE=2 SV=3
11	PDB:1wq8A	0.302	0.657	5.002E-5	100	0.095	0.230	1wq8A.pdb.gz
12	PDB:1hcnB	0.249	0.507	1.644E-2	110	0.075	0.164	1hcnB.pdb.gz
13	PDB:7y1rB	0.170	0.140	4.011E-2	308	0.058	0.045	7y1rB.pdb.gz
14	PDB:5vqfB	0.194	0.153	5.924E-2	320	0.079	0.059	5vqfB.pdb.gz
15	PDB:4my2A	0.265	0.144	6.623E-2	474	0.095	0.049	4my2A.pdb.gz	Structure and function of Norrin in assembly and activation of a Frizzled 4-Lrp5/6 complex.
16	PDB:5ffoG	0.181	0.154	7.404E-2	297	0.075	0.061	5ffoG.pdb.gz	Force interacts with macromolecular structure in activation of TGF-beta.
17	PDB:3rjrC	0.188	0.140	9.783E-2	343	0.079	0.055	3rjrC.pdb.gz
18	PDB:7t9iB	0.239	0.487	1.223E-1	109	0.083	0.183	7t9iB.pdb.gz
19	PDB:2k8pA	0.238	0.286	1.293E-1	189	0.145	0.185	2k8pA.pdb.gz
20	PDB:1m4uA	0.208	0.243	1.615E-1	199	0.062	0.075	1m4uA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P01127	0.0	497	241	1.000	1.000	PDGFB_HUMAN Platelet-derived growth factor subunit B OS=Homo sapiens OX=9606 GN=PDGFB PE=1 SV=1
2	P31240	1.85e-161	448	241	0.892	0.892	PDGFB_MOUSE Platelet-derived growth factor subunit B OS=Mus musculus OX=10090 GN=Pdgfb PE=2 SV=1
3	B1H0W5	3.06e-161	447	241	0.913	0.913	B1H0W5_BOVIN PDGFB protein OS=Bos taurus OX=9913 GN=PDGFB PE=2 SV=1
4	Q05028	3.16e-136	384	225	0.817	0.876	PDGFB_RAT Platelet-derived growth factor subunit B (Fragment) OS=Rattus norvegicus OX=10116 GN=Pdgfb PE=2 SV=1
5	Q90WK1	1.75e-43	147	194	0.344	0.428	Q90WK1_CHICK Platelet derived growth factor subunit A OS=Gallus gallus OX=9031 GN=PDGF-A (S2) PE=2 SV=1
6	P28576	1.51e-41	142	204	0.332	0.392	PDGFA_RAT Platelet-derived growth factor subunit A OS=Rattus norvegicus OX=10116 GN=Pdgfa PE=2 SV=2
7	P20033	3.47e-41	142	211	0.332	0.379	PDGFA_MOUSE Platelet-derived growth factor subunit A OS=Mus musculus OX=10090 GN=Pdgfa PE=2 SV=2
8	A5PMP7	9.57e-41	140	194	0.328	0.407	A5PMP7_DANRE Platelet-derived growth factor alpha a precursor OS=Danio rerio OX=7955 GN=LOC103909601 PE=3 SV=1
9	P04085	1.20e-39	138	211	0.324	0.370	PDGFA_HUMAN Platelet-derived growth factor subunit A OS=Homo sapiens OX=9606 GN=PDGFA PE=1 SV=1
10	Q9BLX1	1.77e-07	53.1	314	0.154	0.118	Q9BLX1_DROME PDGF-and VEGF-related factor 1, isoform B OS=Drosophila melanogaster OX=7227 GN=Pvf1 PE=2 SV=1
11	Q9VWP6	1.91e-07	53.1	325	0.154	0.114	Q9VWP6_DROME LD28763p OS=Drosophila melanogaster OX=7227 GN=Pvf1 PE=2 SV=3
12	X2JCH3	2.71e-07	52.8	300	0.154	0.123	X2JCH3_DROME PDGF-and VEGF-related factor 1, isoform C OS=Drosophila melanogaster OX=7227 GN=Pvf1 PE=3 SV=1
13	P49765	9.97e-07	50.1	207	0.166	0.193	VEGFB_HUMAN Vascular endothelial growth factor B OS=Homo sapiens OX=9606 GN=VEGFB PE=1 SV=2
14	Q7LAP4	9.97e-07	50.1	207	0.166	0.193	Q7LAP4_HUMAN Vascular endothelial growth factor B OS=Homo sapiens OX=9606 GN=VEGFB PE=1 SV=1
15	P49766	2.77e-06	48.9	207	0.116	0.135	VEGFB_MOUSE Vascular endothelial growth factor B OS=Mus musculus OX=10090 GN=Vegfb PE=2 SV=2
16	O35757	5.22e-06	48.9	415	0.187	0.108	VEGFC_RAT Vascular endothelial growth factor C OS=Rattus norvegicus OX=10116 GN=Vegfc PE=1 SV=2
17	P97946	8.28e-06	48.1	358	0.129	0.087	VEGFD_MOUSE Vascular endothelial growth factor D OS=Mus musculus OX=10090 GN=Vegfd PE=2 SV=1
18	O35485	1.33e-05	47.0	207	0.112	0.130	VEGFB_RAT Vascular endothelial growth factor B OS=Rattus norvegicus OX=10116 GN=Vegfb PE=2 SV=3
19	O35251	1.39e-05	47.8	326	0.129	0.095	VEGFD_RAT Vascular endothelial growth factor D OS=Rattus norvegicus OX=10116 GN=Vegfd PE=1 SV=1
20	P97953	2.65e-05	47.0	415	0.166	0.096	VEGFC_MOUSE Vascular endothelial growth factor C OS=Mus musculus OX=10090 GN=Vegfc PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00341 PDGF	8.5e-21	85.4	PDGF/VEGF domain
2	PF04692 PDGF_N	1.5e-12	59.4	Platelet-derived growth factor, N terminal region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000330382

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261799	0.999	Platelet-derived growth factor receptor beta
2	9606.ENSP00000257290	0.997	Platelet-derived growth factor receptor alpha
3	9606.ENSP00000422464	0.989	Platelet-derived growth factor C
4	9606.ENSP00000376865	0.965	Platelet-derived growth factor D
5	9606.ENSP00000243077	0.958	Prolow-density lipoprotein receptor-related protein 1
6	9606.ENSP00000407586	0.955	GTPase HRas
7	9606.ENSP00000451828	0.952	RAC-alpha serine/threonine-protein kinase
8	9606.ENSP00000263923	0.949	Vascular endothelial growth factor receptor 2
9	9606.ENSP00000362680	0.945	Proto-oncogene tyrosine-protein kinase Src
10	9606.ENSP00000346508	0.944	Platelet-derived growth factor subunit A
11	9606.ENSP00000361021	0.942	Phosphatase and tensin homolog
12	9606.ENSP00000361423	0.940	Tyrosine-protein kinase ABL1
13	9606.ENSP00000256078	0.936	GTPase KRas
14	9606.ENSP00000264657	0.936	Signal transducer and activator of transcription 3
15	9606.ENSP00000282397	0.936	Vascular endothelial growth factor receptor 1
16	9606.ENSP00000428056	0.935	Phosphatidylinositol 3-kinase regulatory subunit alpha
17	9606.ENSP00000352121	0.929	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
18	9606.ENSP00000261023	0.925	Integrin alpha-V
19	9606.ENSP00000261937	0.925	Vascular endothelial growth factor receptor 3
20	9606.ENSP00000452786	0.923	Integrin beta-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0070851	1.000	growth factor receptor binding
GO:0008083	1.000	growth factor activity
GO:0042802	0.996	identical protein binding
GO:0044877	0.953	protein-containing complex binding
GO:0046983	0.925	protein dimerization activity
GO:0019838	0.910	growth factor binding
GO:0046982	0.881	protein heterodimerization activity
GO:0005518	0.876	collagen binding
GO:0042803	0.872	protein homodimerization activity
GO:0005161	0.661	platelet-derived growth factor receptor binding
GO:0005126	0.489	cytokine receptor binding
GO:0005172	0.362	vascular endothelial growth factor receptor binding
GO:0048407	0.302	platelet-derived growth factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009893	0.996	positive regulation of metabolic process
GO:0051246	0.995	regulation of protein metabolic process
GO:0008284	0.995	positive regulation of cell population proliferation
GO:1902531	0.995	regulation of intracellular signal transduction
GO:0042325	0.995	regulation of phosphorylation
GO:0007169	0.995	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0042221	0.992	response to chemical
GO:0010604	0.990	positive regulation of macromolecule metabolic process
GO:2000145	0.988	regulation of cell motility
GO:0006950	0.987	response to stress
GO:0040017	0.987	positive regulation of locomotion
GO:0048008	0.985	platelet-derived growth factor receptor signaling pathway
GO:0031325	0.984	positive regulation of cellular metabolic process
GO:0070887	0.983	cellular response to chemical stimulus
GO:0071900	0.982	regulation of protein serine/threonine kinase activity
GO:0071495	0.981	cellular response to endogenous stimulus
GO:0032501	0.977	multicellular organismal process
GO:0048146	0.976	positive regulation of fibroblast proliferation
GO:0043410	0.975	positive regulation of MAPK cascade
GO:0043406	0.974	positive regulation of MAP kinase activity
GO:0048856	0.965	anatomical structure development
GO:0051239	0.957	regulation of multicellular organismal process
GO:0048660	0.953	regulation of smooth muscle cell proliferation
GO:0030335	0.949	positive regulation of cell migration
GO:0007275	0.947	multicellular organism development
GO:0010468	0.941	regulation of gene expression
GO:0048661	0.938	positive regulation of smooth muscle cell proliferation
GO:0048519	0.930	negative regulation of biological process
GO:0051052	0.912	regulation of DNA metabolic process
GO:0009889	0.908	regulation of biosynthetic process
GO:0009891	0.882	positive regulation of biosynthetic process
GO:0048731	0.879	system development
GO:0051128	0.857	regulation of cellular component organization
GO:0051054	0.853	positive regulation of DNA metabolic process
GO:0050678	0.845	regulation of epithelial cell proliferation
GO:0001936	0.843	regulation of endothelial cell proliferation
GO:0048513	0.842	animal organ development
GO:0010632	0.839	regulation of epithelial cell migration
GO:0071363	0.835	cellular response to growth factor stimulus
GO:0009628	0.821	response to abiotic stimulus
GO:0010033	0.819	response to organic substance
GO:0010594	0.812	regulation of endothelial cell migration
GO:0050730	0.811	regulation of peptidyl-tyrosine phosphorylation
GO:1901700	0.797	response to oxygen-containing compound
GO:0014910	0.797	regulation of smooth muscle cell migration
GO:0042060	0.795	wound healing
GO:0048523	0.768	negative regulation of cellular process
GO:0048585	0.763	negative regulation of response to stimulus
GO:0014066	0.763	regulation of phosphatidylinositol 3-kinase signaling
GO:0071310	0.760	cellular response to organic substance
GO:0010634	0.758	positive regulation of epithelial cell migration
GO:0008152	0.754	metabolic process
GO:0031326	0.739	regulation of cellular biosynthetic process
GO:0009892	0.731	negative regulation of metabolic process
GO:0014068	0.731	positive regulation of phosphatidylinositol 3-kinase signaling
GO:0050793	0.728	regulation of developmental process
GO:0010556	0.728	regulation of macromolecule biosynthetic process
GO:0032101	0.721	regulation of response to external stimulus
GO:0050679	0.718	positive regulation of epithelial cell proliferation
GO:0071704	0.709	organic substance metabolic process
GO:0065008	0.704	regulation of biological quality
GO:0009605	0.700	response to external stimulus
GO:0044238	0.695	primary metabolic process
GO:0014911	0.695	positive regulation of smooth muscle cell migration
GO:0006355	0.695	regulation of DNA-templated transcription
GO:0051240	0.688	positive regulation of multicellular organismal process
GO:0050878	0.671	regulation of body fluid levels
GO:0050920	0.659	regulation of chemotaxis
GO:0001938	0.637	positive regulation of endothelial cell proliferation
GO:0010595	0.633	positive regulation of endothelial cell migration
GO:0035556	0.625	intracellular signal transduction
GO:0044237	0.621	cellular metabolic process
GO:0035295	0.619	tube development
GO:0006807	0.597	nitrogen compound metabolic process
GO:0032103	0.588	positive regulation of response to external stimulus
GO:0016477	0.582	cell migration
GO:1904705	0.543	regulation of vascular associated smooth muscle cell proliferation
GO:0003006	0.527	developmental process involved in reproduction
GO:0009725	0.526	response to hormone
GO:0009653	0.521	anatomical structure morphogenesis
GO:0043170	0.509	macromolecule metabolic process
GO:0050921	0.442	positive regulation of chemotaxis
GO:0071840	0.381	cellular component organization or biogenesis
GO:0001666	0.375	response to hypoxia
GO:1904707	0.362	positive regulation of vascular associated smooth muscle cell proliferation
GO:1901564	0.350	organonitrogen compound metabolic process
GO:0016043	0.336	cellular component organization
GO:0036294	0.332	cellular response to decreased oxygen levels

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.998	extracellular region
GO:0071944	0.997	cell periphery
GO:0016020	0.996	membrane
GO:0005737	0.996	cytoplasm
GO:0012505	0.994	endomembrane system
GO:0070013	0.994	intracellular organelle lumen
GO:0005886	0.973	plasma membrane
GO:0043227	0.970	membrane-bounded organelle
GO:0043231	0.957	intracellular membrane-bounded organelle
GO:0005615	0.947	extracellular space
GO:0031410	0.865	cytoplasmic vesicle
GO:0099503	0.743	secretory vesicle
GO:0032991	0.740	protein-containing complex
GO:0030141	0.715	secretory granule
GO:0034774	0.705	secretory granule lumen
GO:0009986	0.632	cell surface
GO:0031090	0.617	organelle membrane
GO:0005794	0.565	Golgi apparatus
GO:0031012	0.554	extracellular matrix
GO:0031091	0.537	platelet alpha granule
GO:0062023	0.528	collagen-containing extracellular matrix
GO:0005788	0.522	endoplasmic reticulum lumen
GO:0098588	0.508	bounding membrane of organelle
GO:0031093	0.447	platelet alpha granule lumen
GO:0031981	0.443	nuclear lumen
GO:0005654	0.411	nucleoplasm
GO:1903561	0.328	extracellular vesicle
GO:0070062	0.318	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]