StarFunc result for job id P01133

User Input

>input (1207 residues)
MLLTLIILLPVVSKFSFVSLSAPQHWSCPEGTLAGNGNSTCVGPAPFLIFSHGNSIFRID
TEGTNYEQLVVDAGVSVIMDFHYNEKRIYWVDLERQLLQRVFLNGSRQERVCNIEKNVSG
MAINWINEEVIWSNQQEGIITVTDMKGNNSHILLSALKYPANVAVDPVERFIFWSSEVAG
SLYRADLDGVGVKALLETSEKITAVSLDVLDKRLFWIQYNREGSNSLICSCDYDGGSVHI
SKHPTQHNLFAMSLFGDRIFYSTWKMKTIWIANKHTGKDMVRINLHSSFVPLGELKVVHP
LAQPKAEDDTWEPEQKLCKLRKGNCSSTVCGQDLQSHLCMCAEGYALSRDRKYCEDVNEC
AFWNHGCTLGCKNTPGSYYCTCPVGFVLLPDGKRCHQLVSCPRNVSECSHDCVLTSEGPL
CFCPEGSVLERDGKTCSGCSSPDNGGCSQLCVPLSPVSWECDCFPGYDLQLDEKSCAASG
PQPFLLFANSQDIRHMHFDGTDYGTLLSQQMGMVYALDHDPVENKIYFAHTALKWIERAN
MDGSQRERLIEEGVDVPEGLAVDWIGRRFYWTDRGKSLIGRSDLNGKRSKIITKENISQP
RGIAVHPMAKRLFWTDTGINPRIESSSLQGLGRLVIASSDLIWPSGITIDFLTDKLYWCD
AKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDYVWFSDWAMPSVMRVNKRTGKDRVR
LQGSMLKPSSLVVVHPLAKPGADPCLYQNGGCEHICKKRLGTAWCSCREGFMKASDGKTC
LALDGHQLLAGGEVDLKNQVTPLDILSKTRVSEDNITESQHMLVAEIMVSDQDDCAPVGC
SMYARCISEGEDATCQCLKGFAGDGKLCSDIDECEMGVPVCPPASSKCINTEGGYVCRCS
EGYQGDGIHCLDIDECQLGEHSCGENASCTNTEGGYTCMCAGRLSEPGLICPDSTPPPHL
REDDHHYSVRNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWW
ELRHAGHGQQQKVIVVAVCVVVLVMLLLLSLWGAHYYRTQKLLSKNPKNPYEESSRDVRS
RRPADTEDGMSSCPQPWFVVIKEHQDLKNGGQPVAGEDGQAADGSMQPTSWRQEPQLCGM
GTEQGCWIPVSSDKGSCPQVMERSFHMPSYGTQTLEGGVEKPHSLLSANPLWQQRALDPP
HQMELTQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A140LGI0	0.310	0.316	0.000	1176	0.382	0.392	A0A140LGI0.pdb.gz
2	AFDB:P01132	0.507	0.503	0.000	1217	0.665	0.660	P01132.pdb.gz	EGF_MOUSE Pro-epidermal growth factor OS=Mus musculus OX=10090 GN=Egf PE=1 SV=2
3	AFDB:P01133	1.000	1.000	0.000	1207	1.000	1.000	P01133.pdb.gz	EGF_HUMAN Pro-epidermal growth factor OS=Homo sapiens OX=9606 GN=EGF PE=1 SV=2
4	AFDB:P07522	0.500	0.529	0.000	1133	0.628	0.669	P07522.pdb.gz	EGF_RAT Pro-epidermal growth factor OS=Rattus norvegicus OX=10116 GN=Egf PE=1 SV=2
5	AFDB:P98155	0.263	0.357	3.130E-39	873	0.118	0.164	P98155.pdb.gz	VLDLR_HUMAN Very low-density lipoprotein receptor OS=Homo sapiens OX=9606 GN=VLDLR PE=1 SV=1
6	AFDB:Q53TL0	0.264	0.402	9.746E-36	773	0.107	0.167	Q53TL0.pdb.gz	Q53TL0_HUMAN Uncharacterized protein LRP2 (Fragment) OS=Homo sapiens OX=9606 GN=LRP2 PE=4 SV=1
7	AFDB:P14543	0.212	0.205	1.908E-32	1247	0.133	0.129	P14543.pdb.gz	NID1_HUMAN Nidogen-1 OS=Homo sapiens OX=9606 GN=NID1 PE=1 SV=3
8	AFDB:P10493	0.212	0.206	8.226E-31	1245	0.130	0.126	P10493.pdb.gz	NID1_MOUSE Nidogen-1 OS=Mus musculus OX=10090 GN=Nid1 PE=1 SV=2
9	AFDB:C7FZU4	0.241	0.234	1.243E-30	1248	0.137	0.132	C7FZU4.pdb.gz	C7FZU4_CAEEL Nidogen OS=Caenorhabditis elegans OX=6239 GN=nid-1 PE=1 SV=1
10	AFDB:Q93791	0.209	0.160	1.332E-29	1584	0.123	0.094	Q93791.pdb.gz	Q93791_CAEEL Nidogen OS=Caenorhabditis elegans OX=6239 GN=nid-1 PE=1 SV=2
11	PDB:7mq8LT	0.167	0.222	2.528E-16	869	0.064	0.089	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:1n6dA	0.169	0.193	4.458E-16	1023	0.068	0.080	1n6dA.pdb.gz	Navigation Inside a Protease: Substrate Selection and Product Exit in the Tricorn Protease from Thermoplasma acidophilum
13	PDB:7mq8LR	0.188	0.275	6.735E-16	773	0.056	0.088	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:7mq8LO	0.214	0.284	3.004E-15	848	0.060	0.085	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:6lqsB1	0.163	0.235	3.390E-14	806	0.054	0.081	6lqsB1.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
16	PDB:7ajuUL	0.162	0.240	3.569E-14	779	0.065	0.101	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
17	PDB:7mqaLQ	0.204	0.277	3.569E-14	830	0.051	0.073	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:7mqaLO	0.194	0.266	4.863E-14	819	0.052	0.077	7mqaLO.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:7ajtUA	0.170	0.224	6.293E-14	834	0.059	0.085	7ajtUA.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
20	PDB:7rroe	0.230	0.394	9.506E-14	610	0.070	0.138	7rroe.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P01132	0.0	1612	1217	0.663	0.657	EGF_MOUSE Pro-epidermal growth factor OS=Mus musculus OX=10090 GN=Egf PE=1 SV=2
2	P01133	0.0	2509	1207	1.000	1.000	EGF_HUMAN Pro-epidermal growth factor OS=Homo sapiens OX=9606 GN=EGF PE=1 SV=2
3	P07522	0.0	1546	1133	0.631	0.673	EGF_RAT Pro-epidermal growth factor OS=Rattus norvegicus OX=10116 GN=Egf PE=1 SV=2
4	Q6VQA2	0.0	847	1114	0.354	0.383	Q6VQA2_DANRE Pro-epidermal growth factor OS=Danio rerio OX=7955 GN=egf PE=2 SV=1
5	O75096	1.30e-79	290	1905	0.140	0.089	LRP4_HUMAN Low-density lipoprotein receptor-related protein 4 OS=Homo sapiens OX=9606 GN=LRP4 PE=1 SV=4
6	Q9QYP1	3.67e-79	289	1905	0.138	0.088	LRP4_RAT Low-density lipoprotein receptor-related protein 4 OS=Rattus norvegicus OX=10116 GN=Lrp4 PE=1 SV=2
7	Q8VI56	8.36e-79	288	1905	0.138	0.087	LRP4_MOUSE Low-density lipoprotein receptor-related protein 4 OS=Mus musculus OX=10090 GN=Lrp4 PE=1 SV=3
8	Q91ZX7	4.12e-69	258	4545	0.122	0.032	LRP1_MOUSE Prolow-density lipoprotein receptor-related protein 1 OS=Mus musculus OX=10090 GN=Lrp1 PE=1 SV=1
9	G3V928	3.00e-68	256	4545	0.121	0.032	LRP1_RAT Prolow-density lipoprotein receptor-related protein 1 OS=Rattus norvegicus OX=10116 GN=Lrp1 PE=1 SV=1
10	Q07954	4.05e-68	255	4544	0.122	0.032	LRP1_HUMAN Prolow-density lipoprotein receptor-related protein 1 OS=Homo sapiens OX=9606 GN=LRP1 PE=1 SV=2
11	Q59FG2	1.20e-67	253	2359	0.122	0.062	Q59FG2_HUMAN Low density lipoprotein-related protein 1 variant (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
12	F1MAD0	1.89e-67	252	1473	0.156	0.128	F1MAD0_RAT LDL receptor related protein 5 OS=Rattus norvegicus OX=10116 GN=Lrp5 PE=4 SV=3
13	O75197	1.92e-67	252	1615	0.153	0.115	LRP5_HUMAN Low-density lipoprotein receptor-related protein 5 OS=Homo sapiens OX=9606 GN=LRP5 PE=1 SV=2
14	A0A8I6G721	3.59e-67	251	1560	0.156	0.121	A0A8I6G721_RAT Low-density lipoprotein receptor-related protein OS=Rattus norvegicus OX=10116 GN=Lrp5 PE=3 SV=1
15	B5L5I6	7.33e-67	250	1620	0.114	0.085	B5L5I6_DANRE Low-density lipoprotein receptor-related protein OS=Danio rerio OX=7955 GN=lrp6 PE=1 SV=1
16	E1BGJ0	8.07e-67	251	4545	0.120	0.032	E1BGJ0_BOVIN LDL receptor related protein 1 OS=Bos taurus OX=9913 GN=LRP1 PE=1 SV=3
17	B2RYI1	4.13e-66	248	1600	0.155	0.117	B2RYI1_RAT Low-density lipoprotein receptor-related protein OS=Rattus norvegicus OX=10116 GN=Lrp5 PE=2 SV=1
18	Q91VN0	5.35e-66	248	1614	0.154	0.115	LRP5_MOUSE Low-density lipoprotein receptor-related protein 5 OS=Mus musculus OX=10090 GN=Lrp5 PE=1 SV=3
19	E9QGD4	1.58e-65	241	870	0.114	0.159	E9QGD4_DANRE Low density lipoprotein receptor a OS=Danio rerio OX=7955 GN=ldlr PE=4 SV=1
20	A0A2R8PYI8	1.70e-65	243	968	0.109	0.135	A0A2R8PYI8_DANRE Low density lipoprotein receptor-related protein 4 OS=Danio rerio OX=7955 GN=eni PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12662 cEGF	2.4e-17	73.8	Complement Clr-like EGF-like
2	PF16472 DUF5050	7.7e-08	43.4	Domain of unknown function (DUF5050)
3	PF00008 EGF	1.1e-18	78.5	EGF-like domain
4	PF12947 EGF_3	5.4e-12	57.0	EGF domain
5	PF07645 EGF_CA	4.8e-18	76.4	Calcium-binding EGF domain
6	PF14670 FXa_inhibition	2.1e-22	90.4	Coagulation Factor Xa inhibitory site
7	PF00058 Ldl_recept_b	1.6e-39	145.4	Low-density lipoprotein receptor repeat class B
8	PF08450 SGL	0.53	21.4	SMP-30/Gluconolactonase/LRE-like region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265171

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000267101	0.999	Receptor tyrosine-protein kinase erbB-3
2	9606.ENSP00000269571	0.999	Receptor tyrosine-protein kinase erbB-2
3	9606.ENSP00000275493	0.999	Epidermal growth factor receptor
4	9606.ENSP00000376345	0.998	Growth factor receptor-bound protein 2
5	9606.ENSP00000342235	0.995	Receptor tyrosine-protein kinase erbB-4
6	9606.ENSP00000303208	0.989	Proprotein convertase subtilisin/kexin type 9
7	9606.ENSP00000327801	0.989	Protein disulfide-isomerase
8	9606.ENSP00000362680	0.986	Proto-oncogene tyrosine-protein kinase Src
9	9606.ENSP00000401303	0.986	SHC-transforming protein 1
10	9606.ENSP00000261769	0.984	Cadherin-1
11	9606.ENSP00000244007	0.982	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
12	9606.ENSP00000344456	0.979	Catenin beta-1
13	9606.ENSP00000380432	0.979	Insulin
14	9606.ENSP00000256078	0.977	GTPase KRas
15	9606.ENSP00000264657	0.977	Signal transducer and activator of transcription 3
16	9606.ENSP00000407586	0.977	GTPase HRas
17	9606.ENSP00000431418	0.977	High affinity nerve growth factor receptor
18	9606.ENSP00000302665	0.973	Insulin-like growth factor I
19	9606.ENSP00000264033	0.972	E3 ubiquitin-protein ligase CBL
20	9606.ENSP00000339191	0.972	Caveolin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005154	0.999	epidermal growth factor receptor binding
GO:0048018	0.999	receptor ligand activity
GO:0030297	0.996	transmembrane receptor protein tyrosine kinase activator activity
GO:0005085	0.979	guanyl-nucleotide exchange factor activity
GO:0008083	0.978	growth factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.982	cellular process
GO:0050794	0.982	regulation of cellular process
GO:0050896	0.977	response to stimulus
GO:0051716	0.963	cellular response to stimulus
GO:0032501	0.960	multicellular organismal process
GO:0048856	0.960	anatomical structure development
GO:0048518	0.958	positive regulation of biological process
GO:0019222	0.938	regulation of metabolic process
GO:0007154	0.924	cell communication
GO:0007169	0.906	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0007275	0.904	multicellular organism development
GO:0051171	0.891	regulation of nitrogen compound metabolic process
GO:0048522	0.875	positive regulation of cellular process
GO:0080090	0.865	regulation of primary metabolic process
GO:0048731	0.864	system development
GO:0045859	0.830	regulation of protein kinase activity
GO:0050678	0.810	regulation of epithelial cell proliferation
GO:0042327	0.809	positive regulation of phosphorylation
GO:0048519	0.798	negative regulation of biological process
GO:0001934	0.795	positive regulation of protein phosphorylation
GO:0043408	0.789	regulation of MAPK cascade
GO:0043085	0.784	positive regulation of catalytic activity
GO:0051130	0.775	positive regulation of cellular component organization
GO:1902533	0.772	positive regulation of intracellular signal transduction
GO:0050679	0.771	positive regulation of epithelial cell proliferation
GO:0033674	0.768	positive regulation of kinase activity
GO:0051239	0.766	regulation of multicellular organismal process
GO:0051094	0.761	positive regulation of developmental process
GO:0043410	0.754	positive regulation of MAPK cascade
GO:0045860	0.748	positive regulation of protein kinase activity
GO:0061097	0.741	regulation of protein tyrosine kinase activity
GO:2000145	0.732	regulation of cell motility
GO:0051049	0.727	regulation of transport
GO:0031326	0.722	regulation of cellular biosynthetic process
GO:0033043	0.715	regulation of organelle organization
GO:0051054	0.710	positive regulation of DNA metabolic process
GO:0061098	0.698	positive regulation of protein tyrosine kinase activity
GO:0030334	0.672	regulation of cell migration
GO:0014066	0.665	regulation of phosphatidylinositol 3-kinase signaling
GO:0010556	0.663	regulation of macromolecule biosynthetic process
GO:0010638	0.629	positive regulation of organelle organization
GO:0071900	0.628	regulation of protein serine/threonine kinase activity
GO:0007173	0.618	epidermal growth factor receptor signaling pathway
GO:0051726	0.602	regulation of cell cycle
GO:0051783	0.586	regulation of nuclear division
GO:0051785	0.562	positive regulation of nuclear division
GO:0071902	0.557	positive regulation of protein serine/threonine kinase activity
GO:0043405	0.556	regulation of MAP kinase activity
GO:0071704	0.530	organic substance metabolic process
GO:0044238	0.518	primary metabolic process
GO:0010564	0.501	regulation of cell cycle process
GO:0010468	0.486	regulation of gene expression
GO:0045787	0.479	positive regulation of cell cycle
GO:0048523	0.472	negative regulation of cellular process
GO:0090068	0.472	positive regulation of cell cycle process
GO:0007088	0.460	regulation of mitotic nuclear division
GO:0006807	0.437	nitrogen compound metabolic process
GO:0044237	0.405	cellular metabolic process
GO:0045840	0.405	positive regulation of mitotic nuclear division
GO:0048513	0.382	animal organ development
GO:0009891	0.378	positive regulation of biosynthetic process
GO:0042221	0.370	response to chemical
GO:0051240	0.343	positive regulation of multicellular organismal process
GO:0009653	0.303	anatomical structure morphogenesis
GO:0043170	0.301	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0071944	0.998	cell periphery
GO:0005615	0.994	extracellular space
GO:0016020	0.989	membrane
GO:0012505	0.989	endomembrane system
GO:0043231	0.980	intracellular membrane-bounded organelle
GO:0005737	0.979	cytoplasm
GO:0005886	0.962	plasma membrane
GO:0031982	0.910	vesicle
GO:1903561	0.890	extracellular vesicle
GO:0070062	0.859	extracellular exosome
GO:0031410	0.842	cytoplasmic vesicle
GO:0031090	0.827	organelle membrane
GO:0043233	0.753	organelle lumen
GO:0070013	0.743	intracellular organelle lumen
GO:0030139	0.500	endocytic vesicle
GO:0098588	0.495	bounding membrane of organelle
GO:0030141	0.475	secretory granule
GO:0030659	0.466	cytoplasmic vesicle membrane
GO:0005773	0.442	vacuole
GO:0000323	0.418	lytic vacuole
GO:0030135	0.414	coated vesicle
GO:0030666	0.407	endocytic vesicle membrane
GO:0005764	0.353	lysosome
GO:0030136	0.332	clathrin-coated vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]