StarFunc result for job id P01135

User Input

>input (160 residues)
MVPSAGQLALFALGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTC
RFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVL
IHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P01135	1.000	1.000	1.576E-28	160	1.000	1.000	P01135.pdb.gz	TGFA_HUMAN Protransforming growth factor alpha OS=Homo sapiens OX=9606 GN=TGFA PE=1 SV=1
2	AFDB:Q6J1M9	0.481	0.491	1.679E-15	156	0.713	0.731	Q6J1M9.pdb.gz	Q6J1M9_CHICK Transforming growth factor alpha OS=Gallus gallus OX=9031 PE=2 SV=1
3	AFDB:Q64EU6	0.400	0.380	3.978E-9	171	0.269	0.251	Q64EU6.pdb.gz	Q64EU6_CHICK Betacellulin OS=Gallus gallus OX=9031 GN=BTC PE=2 SV=1
4	AFDB:Q05928	0.410	0.377	5.141E-9	177	0.275	0.249	Q05928.pdb.gz	BTC_MOUSE Probetacellulin OS=Mus musculus OX=10090 GN=Btc PE=1 SV=1
5	AFDB:P35070	0.412	0.376	4.545E-8	178	0.294	0.264	P35070.pdb.gz	BTC_HUMAN Probetacellulin OS=Homo sapiens OX=9606 GN=BTC PE=1 SV=1
6	AFDB:Q6UW88	0.333	0.343	1.194E-6	154	0.200	0.208	Q6UW88.pdb.gz	EPGN_HUMAN Epigen OS=Homo sapiens OX=9606 GN=EPGN PE=1 SV=2
7	AFDB:Q924X1	0.303	0.317	2.267E-6	152	0.219	0.230	Q924X1.pdb.gz	EPGN_MOUSE Epigen OS=Mus musculus OX=10090 GN=Epgn PE=2 SV=1
8	AFDB:Q61521	0.346	0.342	3.124E-6	162	0.225	0.222	Q61521.pdb.gz	EREG_MOUSE Proepiregulin OS=Mus musculus OX=10090 GN=Ereg PE=1 SV=1
9	AFDB:O14944	0.341	0.325	8.712E-6	169	0.231	0.219	O14944.pdb.gz	EREG_HUMAN Proepiregulin OS=Homo sapiens OX=9606 GN=EREG PE=1 SV=1
10	AFDB:A0A140LGI0	0.272	0.045	1.551E-5	1176	0.181	0.025	A0A140LGI0.pdb.gz
11	PDB:3t5oA	0.211	0.043	7.235E-1	871	0.075	0.014	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
12	PDB:7nycC	0.204	0.044	7.235E-1	809	0.075	0.015	7nycC.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
13	PDB:5f1aA	0.208	0.065	1.208	553	0.081	0.024	5f1aA.pdb.gz	Crystal Structure of Aspirin-Acetylated Human Cyclooxygenase-2: Insight into the Formation of Products with Reversed Stereochemistry.
14	PDB:2hoxD	0.165	0.065	1.374	427	0.069	0.026	2hoxD.pdb.gz	Two Structures of Alliinase from Alliium sativum L.: Apo Form and Ternary Complex with Aminoacrylate Reaction Intermediate Covalently Bound to the PLP Cofactor.
15	PDB:5es4B	0.203	0.054	1.561	674	0.056	0.013	5es4B.pdb.gz	Leukocyte integrin alpha L beta 2 headpiece structures: The alpha I domain, the pocket for the internal ligand, and concerted movements of its loops.
16	PDB:7nycD	0.153	0.053	1.665	487	0.044	0.014	7nycD.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
17	PDB:7q3nU	0.157	0.092	1.892	292	0.069	0.038	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
18	PDB:6y3cA	0.186	0.059	2.018	557	0.100	0.029	6y3cA.pdb.gz
19	PDB:4rs0A	0.198	0.061	2.151	557	0.056	0.016	4rs0A.pdb.gz	Action at a Distance: MUTATIONS OF PERIPHERAL RESIDUES TRANSFORM RAPID REVERSIBLE INHIBITORS TO SLOW, TIGHT BINDERS OF CYCLOOXYGENASE-2.
20	PDB:6h03C	0.179	0.060	2.445	513	0.056	0.018	6h03C.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P01135	2.24e-113	320	160	1.000	1.000	TGFA_HUMAN Protransforming growth factor alpha OS=Homo sapiens OX=9606 GN=TGFA PE=1 SV=1
2	P48030	6.45e-96	276	159	0.919	0.925	TGFA_MOUSE Protransforming growth factor alpha OS=Mus musculus OX=10090 GN=Tgfa PE=1 SV=1
3	P01134	7.77e-96	275	159	0.925	0.931	TGFA_RAT Protransforming growth factor alpha OS=Rattus norvegicus OX=10116 GN=Tgfa PE=1 SV=2
4	Q6J1M9	1.54e-70	211	156	0.713	0.731	Q6J1M9_CHICK Transforming growth factor alpha OS=Gallus gallus OX=9031 PE=2 SV=1
5	A0A8I5ZSF9	4.55e-15	71.2	193	0.194	0.161	A0A8I5ZSF9_RAT Betacellulin OS=Rattus norvegicus OX=10116 GN=Btc PE=4 SV=1
6	A0A8J8YRH0	4.82e-15	70.9	191	0.194	0.162	A0A8J8YRH0_RAT Betacellulin OS=Rattus norvegicus OX=10116 GN=Btc PE=4 SV=1
7	A0A8I6AQ55	5.06e-15	71.2	199	0.194	0.156	A0A8I6AQ55_RAT Betacellulin OS=Rattus norvegicus OX=10116 GN=Btc PE=4 SV=1
8	Q9JJM4	5.07e-15	70.5	177	0.194	0.175	Q9JJM4_RAT Betacellulin OS=Rattus norvegicus OX=10116 GN=Btc PE=2 SV=1
9	Q64EU6	9.04e-15	69.7	171	0.194	0.181	Q64EU6_CHICK Betacellulin OS=Gallus gallus OX=9031 GN=BTC PE=2 SV=1
10	P35070	5.34e-14	67.8	178	0.188	0.169	BTC_HUMAN Probetacellulin OS=Homo sapiens OX=9606 GN=BTC PE=1 SV=1
11	Q05928	1.09e-13	67.0	177	0.188	0.169	BTC_MOUSE Probetacellulin OS=Mus musculus OX=10090 GN=Btc PE=1 SV=1
12	Q6VQA2	6.54e-10	58.9	1114	0.225	0.032	Q6VQA2_DANRE Pro-epidermal growth factor OS=Danio rerio OX=7955 GN=egf PE=2 SV=1
13	Q9W7C5	3.79e-09	55.5	212	0.194	0.146	HBEGF_CHICK Proheparin-binding EGF-like growth factor OS=Gallus gallus OX=9031 GN=HBEGF PE=1 SV=1
14	Q6UW88	5.58e-09	53.9	154	0.194	0.201	EPGN_HUMAN Epigen OS=Homo sapiens OX=9606 GN=EPGN PE=1 SV=2
15	Q8IYR6	7.68e-09	55.5	380	0.169	0.071	TEFF1_HUMAN Tomoregulin-1 OS=Homo sapiens OX=9606 GN=TMEFF1 PE=1 SV=1
16	Q9UIK5	1.03e-07	52.4	374	0.156	0.067	TEFF2_HUMAN Tomoregulin-2 OS=Homo sapiens OX=9606 GN=TMEFF2 PE=1 SV=1
17	Q924X1	1.47e-07	50.1	152	0.194	0.204	EPGN_MOUSE Epigen OS=Mus musculus OX=10090 GN=Epgn PE=2 SV=1
18	A9JRW9	3.06e-07	50.4	230	0.181	0.126	A9JRW9_DANRE Heparin-binding EGF-like growth factor a OS=Danio rerio OX=7955 GN=hbegfa PE=2 SV=1
19	Q9Z0L5	3.27e-07	49.3	162	0.263	0.259	EREG_RAT Proepiregulin OS=Rattus norvegicus OX=10116 GN=Ereg PE=1 SV=1
20	Q61521	1.59e-06	47.8	162	0.175	0.173	EREG_MOUSE Proepiregulin OS=Mus musculus OX=10090 GN=Ereg PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00008 EGF	5.7	18.7	EGF-like domain
2	PF07974 EGF_2	79	15.0	EGF-like domain
3	PF15102 TMEM154	3.9e+02	12.3	TMEM154 protein family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000012418

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000010419	0.999	Receptor protein-tyrosine kinase
2	61853.ENSNLEP00000001285	0.988	Receptor protein-tyrosine kinase
3	61853.ENSNLEP00000021313	0.965	Erb-b2 receptor tyrosine kinase 3
4	61853.ENSNLEP00000008780	0.928	Receptor protein-tyrosine kinase
5	61853.ENSNLEP00000010045	0.865	Platelet-derived growth factor alpha polypeptide
6	61853.ENSNLEP00000007775	0.855	Insulin-like growth factor 1 (somatomedin C)
7	61853.ENSNLEP00000018484	0.843	Platelet-derived growth factor beta polypeptide
8	61853.ENSNLEP00000020085	0.834	Pro-epidermal growth factor
9	61853.ENSNLEP00000007651	0.807	Platelet derived growth factor C
10	61853.ENSNLEP00000016293	0.806	INS-IGF2 readthrough
11	61853.ENSNLEP00000008772	0.800	Platelet derived growth factor D
12	61853.ENSNLEP00000014096	0.722	Receptor tyrosine kinase that transduces signals from the extracellular matrix into the cytoplasm by binding to hepatocyte growth factor/HGF ligand. Regulates many physiological processes including proliferation, scattering, morphogenesis and survival. Ligand binding at the cell surface induces autophosphorylation of MET on its intracellular domain that provides docking sites for downstream signaling molecules. Following activation by ligand, interacts with the PI3-kinase subunit PIK3R1, PLCG1, SRC, GRB2, STAT3 or the adapter GAB1. Recruitment of these downstream effectors by MET leads [...]
13	61853.ENSNLEP00000012499	0.716	Platelet-derived growth factor receptor beta
14	61853.ENSNLEP00000015369	0.715	Insulin-degrading enzyme
15	61853.ENSNLEP00000000457	0.702	Fms-related tyrosine kinase 3
16	61853.ENSNLEP00000000072	0.700	Uncharacterized protein
17	61853.ENSNLEP00000015352	0.696	Fibroblast growth factor receptor 4
18	61853.ENSNLEP00000010109	0.693	HRas proto-oncogene, GTPase
19	61853.ENSNLEP00000006371	0.684	KRAS proto-oncogene, GTPase
20	61853.ENSNLEP00000014960	0.684	Fibroblast growth factor receptor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005154	1.000	epidermal growth factor receptor binding
GO:0008083	0.999	growth factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050794	0.996	regulation of cellular process
GO:0050896	0.995	response to stimulus
GO:0048522	0.988	positive regulation of cellular process
GO:0007165	0.987	signal transduction
GO:0032502	0.975	developmental process
GO:0007169	0.975	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0032501	0.972	multicellular organismal process
GO:0048856	0.972	anatomical structure development
GO:0060255	0.969	regulation of macromolecule metabolic process
GO:0038127	0.966	ERBB signaling pathway
GO:0080090	0.963	regulation of primary metabolic process
GO:0051171	0.962	regulation of nitrogen compound metabolic process
GO:0031323	0.962	regulation of cellular metabolic process
GO:0007173	0.951	epidermal growth factor receptor signaling pathway
GO:0007275	0.949	multicellular organism development
GO:0050730	0.948	regulation of peptidyl-tyrosine phosphorylation
GO:0042127	0.944	regulation of cell population proliferation
GO:0009893	0.938	positive regulation of metabolic process
GO:0048731	0.929	system development
GO:0008284	0.927	positive regulation of cell population proliferation
GO:0001934	0.926	positive regulation of protein phosphorylation
GO:0048519	0.924	negative regulation of biological process
GO:0048513	0.864	animal organ development
GO:0048583	0.862	regulation of response to stimulus
GO:0051130	0.837	positive regulation of cellular component organization
GO:0050673	0.827	epithelial cell proliferation
GO:0009966	0.819	regulation of signal transduction
GO:0050731	0.815	positive regulation of peptidyl-tyrosine phosphorylation
GO:0048732	0.800	gland development
GO:0051338	0.795	regulation of transferase activity
GO:0009653	0.791	anatomical structure morphogenesis
GO:0010638	0.761	positive regulation of organelle organization
GO:0043549	0.761	regulation of kinase activity
GO:0043085	0.747	positive regulation of catalytic activity
GO:0045859	0.740	regulation of protein kinase activity
GO:0048584	0.720	positive regulation of response to stimulus
GO:0009967	0.711	positive regulation of signal transduction
GO:0051347	0.684	positive regulation of transferase activity
GO:1902533	0.619	positive regulation of intracellular signal transduction
GO:0061008	0.606	hepaticobiliary system development
GO:0033674	0.599	positive regulation of kinase activity
GO:0022612	0.581	gland morphogenesis
GO:0048523	0.572	negative regulation of cellular process
GO:0045860	0.537	positive regulation of protein kinase activity
GO:0001889	0.535	liver development
GO:0050678	0.532	regulation of epithelial cell proliferation
GO:0043408	0.509	regulation of MAPK cascade
GO:0043410	0.504	positive regulation of MAPK cascade
GO:1901184	0.489	regulation of ERBB signaling pathway
GO:0042221	0.473	response to chemical
GO:0035556	0.409	intracellular signal transduction
GO:0010468	0.378	regulation of gene expression
GO:0051783	0.353	regulation of nuclear division
GO:0061097	0.350	regulation of protein tyrosine kinase activity
GO:0050679	0.320	positive regulation of epithelial cell proliferation
GO:0071900	0.312	regulation of protein serine/threonine kinase activity
GO:0006950	0.310	response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.997	extracellular space
GO:0016020	0.988	membrane
GO:0005886	0.981	plasma membrane
GO:0043231	0.976	intracellular membrane-bounded organelle
GO:0012505	0.966	endomembrane system
GO:0005737	0.947	cytoplasm
GO:0031982	0.812	vesicle
GO:0031410	0.695	cytoplasmic vesicle
GO:0098588	0.618	bounding membrane of organelle
GO:0030135	0.608	coated vesicle
GO:0005634	0.592	nucleus
GO:0005829	0.488	cytosol
GO:0030659	0.425	cytoplasmic vesicle membrane
GO:0030669	0.395	clathrin-coated endocytic vesicle membrane
GO:0005793	0.386	endoplasmic reticulum-Golgi intermediate compartment
GO:0033116	0.382	endoplasmic reticulum-Golgi intermediate compartment membrane
GO:0030134	0.381	COPII-coated ER to Golgi transport vesicle
GO:0030658	0.376	transport vesicle membrane
GO:0098590	0.373	plasma membrane region
GO:0012507	0.373	ER to Golgi transport vesicle membrane
GO:0009986	0.370	cell surface
GO:0031984	0.361	organelle subcompartment
GO:0016323	0.358	basolateral plasma membrane
GO:0048471	0.348	perinuclear region of cytoplasm
GO:0005789	0.342	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]