StarFunc result for job id P01137

User Input

>input (390 residues)
MPPSGLRLLLLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA
SPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEI
YDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWR
YLSNRLLAPSDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFT
TGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYI
DFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQA
LEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P01137	1.000	1.000	2.367E-76	390	1.000	1.000	P01137.pdb.gz	TGFB1_HUMAN Transforming growth factor beta-1 proprotein OS=Homo sapiens OX=9606 GN=TGFB1 PE=1 SV=3
2	AFDB:P04202	0.902	0.902	1.002E-62	390	0.897	0.897	P04202.pdb.gz	TGFB1_MOUSE Transforming growth factor beta-1 proprotein OS=Mus musculus OX=10090 GN=Tgfb1 PE=1 SV=1
3	PDB:3rjrC	0.545	0.613	4.460E-47	343	0.821	0.933	3rjrC.pdb.gz
4	PDB:5vqfB	0.534	0.643	1.307E-43	320	0.759	0.925	5vqfB.pdb.gz
5	PDB:5ffoG	0.531	0.681	2.468E-42	297	0.741	0.973	5ffoG.pdb.gz	Force interacts with macromolecular structure in activation of TGF-beta.
6	AFDB:P09531	0.614	0.613	2.614E-42	391	0.567	0.565	P09531.pdb.gz	TGFB1_CHICK Transforming growth factor beta-1 proprotein OS=Gallus gallus OX=9031 GN=TGFB1 PE=2 SV=3
7	PDB:7y1rB	0.523	0.650	8.356E-42	308	0.790	1.000	7y1rB.pdb.gz
8	AFDB:F8W4A6	0.726	0.691	5.958E-38	413	0.464	0.438	F8W4A6.pdb.gz
9	AFDB:F1R741	0.451	0.466	1.805E-37	377	0.444	0.459	F1R741.pdb.gz
10	AFDB:Q07257	0.600	0.542	2.974E-37	442	0.477	0.421	Q07257.pdb.gz	TGFB2_RAT Transforming growth factor beta-2 proprotein OS=Rattus norvegicus OX=10116 GN=Tgfb2 PE=2 SV=2
11	AFDB:P16047	0.435	0.413	3.512E-37	412	0.490	0.464	P16047.pdb.gz	TGFB3_CHICK Transforming growth factor beta-3 proprotein OS=Gallus gallus OX=9031 GN=TGFB3 PE=2 SV=2
12	AFDB:P09858	0.697	0.635	4.498E-36	435	0.459	0.411	P09858.pdb.gz	TGFB2_PIG Transforming growth factor beta-2 proprotein OS=Sus scrofa OX=9823 GN=TGFB2 PE=1 SV=2
13	AFDB:Q66I23	0.421	0.402	5.025E-36	410	0.497	0.473	Q66I23.pdb.gz	Q66I23_DANRE Transforming growth factor beta OS=Danio rerio OX=7955 GN=wu:fc78g09 PE=2 SV=1
14	AFDB:E9QHW0	0.430	0.441	1.652E-34	379	0.438	0.451	E9QHW0.pdb.gz	E9QHW0_DANRE Transforming growth factor beta OS=Danio rerio OX=7955 GN=tgfb1b PE=3 SV=1
15	PDB:5hlyA	0.343	0.418	1.210E-18	299	0.203	0.264	5hlyA.pdb.gz
16	PDB:5ntuA	0.311	0.379	1.784E-18	308	0.215	0.273	5ntuA.pdb.gz
17	PDB:5nxsA	0.311	0.392	1.777E-16	290	0.208	0.279	5nxsA.pdb.gz
18	PDB:6umxA	0.261	0.349	4.801E-14	279	0.205	0.287	6umxA.pdb.gz
19	PDB:5nxsB	0.287	0.424	2.533E-13	251	0.192	0.299	5nxsB.pdb.gz
20	PDB:7chjB	0.086	0.133	3.464E-3	226	0.085	0.146	7chjB.pdb.gz	Molecular basis for cysteine oxidation by plant cysteine oxidases from Arabidopsis thaliana.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P01137	0.0	806	390	1.000	1.000	TGFB1_HUMAN Transforming growth factor beta-1 proprotein OS=Homo sapiens OX=9606 GN=TGFB1 PE=1 SV=3
2	P04202	0.0	692	390	0.844	0.844	TGFB1_MOUSE Transforming growth factor beta-1 proprotein OS=Mus musculus OX=10090 GN=Tgfb1 PE=1 SV=1
3	P07200	0.0	677	390	0.887	0.887	TGFB1_PIG Transforming growth factor beta-1 proprotein OS=Sus scrofa OX=9823 GN=TGFB1 PE=1 SV=2
4	P09533	0.0	796	390	0.987	0.987	TGFB1_CHLAE Transforming growth factor beta-1 proprotein OS=Chlorocebus aethiops OX=9534 GN=TGFB1 PE=1 SV=1
5	P17246	0.0	694	390	0.846	0.846	TGFB1_RAT Transforming growth factor beta-1 proprotein OS=Rattus norvegicus OX=10116 GN=Tgfb1 PE=1 SV=1
6	P18341	0.0	729	390	0.892	0.892	TGFB1_BOVIN Transforming growth factor beta-1 proprotein OS=Bos taurus OX=9913 GN=TGFB1 PE=1 SV=2
7	P09531	1.59e-144	417	391	0.546	0.545	TGFB1_CHICK Transforming growth factor beta-1 proprotein OS=Gallus gallus OX=9031 GN=TGFB1 PE=2 SV=3
8	Q66I23	8.31e-111	332	410	0.485	0.461	Q66I23_DANRE Transforming growth factor beta OS=Danio rerio OX=7955 GN=wu:fc78g09 PE=2 SV=1
9	Q7ZZU7	1.83e-110	330	377	0.459	0.475	Q7ZZU7_DANRE Transforming growth factor beta OS=Danio rerio OX=7955 GN=tgfb1 PE=2 SV=1
10	P16047	1.09e-107	324	412	0.482	0.456	TGFB3_CHICK Transforming growth factor beta-3 proprotein OS=Gallus gallus OX=9031 GN=TGFB3 PE=2 SV=2
11	P27090	2.79e-106	321	414	0.487	0.459	TGFB2_MOUSE Transforming growth factor beta-2 proprotein OS=Mus musculus OX=10090 GN=Tgfb2 PE=1 SV=2
12	P17125	3.76e-106	320	410	0.479	0.456	TGFB3_MOUSE Transforming growth factor beta-3 proprotein OS=Mus musculus OX=10090 GN=Tgfb3 PE=1 SV=1
13	A5YM40	6.05e-106	320	412	0.487	0.461	A5YM40_HUMAN Transforming growth factor beta OS=Homo sapiens OX=9606 GN=TGFB3 PE=2 SV=1
14	P10600	6.05e-106	320	412	0.487	0.461	TGFB3_HUMAN Transforming growth factor beta-3 proprotein OS=Homo sapiens OX=9606 GN=TGFB3 PE=1 SV=1
15	Q07258	1.93e-105	318	412	0.477	0.451	TGFB3_RAT Transforming growth factor beta-3 proprotein OS=Rattus norvegicus OX=10116 GN=Tgfb3 PE=2 SV=2
16	Q07257	4.73e-101	308	442	0.487	0.430	TGFB2_RAT Transforming growth factor beta-2 proprotein OS=Rattus norvegicus OX=10116 GN=Tgfb2 PE=2 SV=2
17	B2R7T2	3.08e-100	305	414	0.472	0.444	B2R7T2_HUMAN Transforming growth factor beta OS=Homo sapiens OX=9606 PE=2 SV=1
18	P61812	3.33e-100	305	414	0.472	0.444	TGFB2_HUMAN Transforming growth factor beta-2 proprotein OS=Homo sapiens OX=9606 GN=TGFB2 PE=1 SV=1
19	E9QHW0	7.78e-100	303	379	0.426	0.438	E9QHW0_DANRE Transforming growth factor beta OS=Danio rerio OX=7955 GN=tgfb1b PE=3 SV=1
20	P09858	5.55e-99	303	435	0.467	0.418	TGFB2_PIG Transforming growth factor beta-2 proprotein OS=Sus scrofa OX=9823 GN=TGFB2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00688 TGFb_propeptide	8e-40	148.6	TGF-beta propeptide
2	PF00019 TGF_beta	3.1e-19	81.1	Transforming growth factor beta like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000221930

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351905	0.999	TGF-beta receptor type-2
2	9606.ENSP00000362299	0.999	Endoglin
3	9606.ENSP00000364133	0.999	TGF-beta receptor type-1
4	9606.ENSP00000052754	0.996	Decorin
5	9606.ENSP00000373574	0.995	Serine/threonine-protein kinase receptor R3
6	9606.ENSP00000386043	0.995	Latent-transforming growth factor beta-binding protein 1
7	9606.ENSP00000212355	0.994	Transforming growth factor beta receptor type 3
8	9606.ENSP00000261023	0.991	Integrin alpha-V
9	9606.ENSP00000361405	0.991	Matrix metalloproteinase-9
10	9606.ENSP00000385675	0.990	Interleukin-6
11	9606.ENSP00000219070	0.988	72 kDa type IV collagenase
12	9606.ENSP00000356954	0.987	Connective tissue growth factor
13	9606.ENSP00000262160	0.985	Mothers against decapentaplegic homolog 2
14	9606.ENSP00000332973	0.985	Mothers against decapentaplegic homolog 3
15	9606.ENSP00000341551	0.985	Mothers against decapentaplegic homolog 4
16	9606.ENSP00000262158	0.980	Mothers against decapentaplegic homolog 7
17	9606.ENSP00000264498	0.978	Fibroblast growth factor 2
18	9606.ENSP00000412237	0.977	Interleukin-10
19	9606.ENSP00000264657	0.963	Signal transducer and activator of transcription 3
20	9606.ENSP00000283249	0.961	Integrin beta-6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0005126	0.996	cytokine receptor binding
GO:0005160	0.991	transforming growth factor beta receptor binding
GO:0140677	0.981	molecular function activator activity
GO:0030545	0.825	signaling receptor regulator activity
GO:0048018	0.806	receptor ligand activity
GO:0019899	0.505	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0009987	0.995	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0051239	0.992	regulation of multicellular organismal process
GO:0050793	0.991	regulation of developmental process
GO:0042127	0.991	regulation of cell population proliferation
GO:0048523	0.991	negative regulation of cellular process
GO:0048522	0.989	positive regulation of cellular process
GO:0032501	0.987	multicellular organismal process
GO:0048583	0.987	regulation of response to stimulus
GO:0031323	0.987	regulation of cellular metabolic process
GO:0009893	0.986	positive regulation of metabolic process
GO:0048856	0.985	anatomical structure development
GO:0007165	0.985	signal transduction
GO:0002682	0.982	regulation of immune system process
GO:0045595	0.976	regulation of cell differentiation
GO:0080090	0.972	regulation of primary metabolic process
GO:0051171	0.972	regulation of nitrogen compound metabolic process
GO:0051240	0.972	positive regulation of multicellular organismal process
GO:0009719	0.967	response to endogenous stimulus
GO:0008284	0.967	positive regulation of cell population proliferation
GO:0009889	0.966	regulation of biosynthetic process
GO:0010714	0.966	positive regulation of collagen metabolic process
GO:0010604	0.965	positive regulation of macromolecule metabolic process
GO:0045597	0.964	positive regulation of cell differentiation
GO:0040012	0.963	regulation of locomotion
GO:0008285	0.962	negative regulation of cell population proliferation
GO:0007166	0.961	cell surface receptor signaling pathway
GO:0050678	0.956	regulation of epithelial cell proliferation
GO:0009891	0.953	positive regulation of biosynthetic process
GO:0032879	0.952	regulation of localization
GO:0010468	0.951	regulation of gene expression
GO:0023051	0.950	regulation of signaling
GO:0030155	0.950	regulation of cell adhesion
GO:0010646	0.950	regulation of cell communication
GO:0060284	0.950	regulation of cell development
GO:2000026	0.948	regulation of multicellular organismal development
GO:0007178	0.946	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0009966	0.939	regulation of signal transduction
GO:0010718	0.939	positive regulation of epithelial to mesenchymal transition
GO:0032967	0.938	positive regulation of collagen biosynthetic process
GO:0051173	0.935	positive regulation of nitrogen compound metabolic process
GO:2000147	0.935	positive regulation of cell motility
GO:0030335	0.934	positive regulation of cell migration
GO:0002684	0.931	positive regulation of immune system process
GO:0071363	0.930	cellular response to growth factor stimulus
GO:0051093	0.927	negative regulation of developmental process
GO:0051174	0.925	regulation of phosphorus metabolic process
GO:1900180	0.925	regulation of protein localization to nucleus
GO:0051241	0.924	negative regulation of multicellular organismal process
GO:0003170	0.920	heart valve development
GO:0031325	0.919	positive regulation of cellular metabolic process
GO:0022407	0.912	regulation of cell-cell adhesion
GO:1903829	0.908	positive regulation of protein localization
GO:0019220	0.907	regulation of phosphate metabolic process
GO:0002683	0.906	negative regulation of immune system process
GO:0051249	0.906	regulation of lymphocyte activation
GO:0071704	0.903	organic substance metabolic process
GO:2000628	0.902	regulation of miRNA metabolic process
GO:1905314	0.901	semi-lunar valve development
GO:0065009	0.899	regulation of molecular function
GO:1900182	0.899	positive regulation of protein localization to nucleus
GO:0030154	0.892	cell differentiation
GO:0031399	0.891	regulation of protein modification process
GO:0042325	0.885	regulation of phosphorylation
GO:0044238	0.880	primary metabolic process
GO:0009653	0.877	anatomical structure morphogenesis
GO:0006355	0.877	regulation of DNA-templated transcription
GO:0048584	0.876	positive regulation of response to stimulus
GO:0044237	0.871	cellular metabolic process
GO:0010033	0.866	response to organic substance
GO:0051254	0.866	positive regulation of RNA metabolic process
GO:1902531	0.859	regulation of intracellular signal transduction
GO:0045893	0.858	positive regulation of DNA-templated transcription
GO:0043170	0.852	macromolecule metabolic process
GO:0006807	0.844	nitrogen compound metabolic process
GO:0006950	0.843	response to stress
GO:0009892	0.840	negative regulation of metabolic process
GO:1901564	0.803	organonitrogen compound metabolic process
GO:0044093	0.801	positive regulation of molecular function
GO:0001932	0.791	regulation of protein phosphorylation
GO:0048585	0.790	negative regulation of response to stimulus
GO:0051247	0.778	positive regulation of protein metabolic process
GO:1901700	0.775	response to oxygen-containing compound
GO:0019538	0.771	protein metabolic process
GO:0080134	0.768	regulation of response to stress
GO:0051128	0.766	regulation of cellular component organization
GO:0010605	0.764	negative regulation of macromolecule metabolic process
GO:0016043	0.759	cellular component organization
GO:0043412	0.751	macromolecule modification
GO:0009887	0.745	animal organ morphogenesis
GO:0023056	0.736	positive regulation of signaling
GO:0010647	0.735	positive regulation of cell communication
GO:0009967	0.731	positive regulation of signal transduction
GO:0048732	0.729	gland development
GO:0010628	0.726	positive regulation of gene expression
GO:0070887	0.723	cellular response to chemical stimulus
GO:0016477	0.711	cell migration
GO:0009605	0.708	response to external stimulus
GO:0010941	0.707	regulation of cell death
GO:0051172	0.698	negative regulation of nitrogen compound metabolic process
GO:0051049	0.681	regulation of transport
GO:0031324	0.668	negative regulation of cellular metabolic process
GO:0009888	0.667	tissue development
GO:0050790	0.659	regulation of catalytic activity
GO:0009628	0.593	response to abiotic stimulus
GO:0048468	0.582	cell development
GO:0022414	0.496	reproductive process
GO:0060485	0.496	mesenchyme development
GO:0030097	0.484	hemopoiesis
GO:0035295	0.450	tube development
GO:0001501	0.448	skeletal system development
GO:0051223	0.422	regulation of protein transport
GO:0007399	0.408	nervous system development
GO:0009790	0.376	embryo development
GO:0060429	0.374	epithelium development
GO:0003007	0.372	heart morphogenesis
GO:0002009	0.329	morphogenesis of an epithelium
GO:0009607	0.314	response to biotic stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.998	extracellular region
GO:0071944	0.982	cell periphery
GO:0005615	0.974	extracellular space
GO:0005622	0.971	intracellular anatomical structure
GO:0005737	0.957	cytoplasm
GO:0070013	0.938	intracellular organelle lumen
GO:0032991	0.868	protein-containing complex
GO:0043227	0.853	membrane-bounded organelle
GO:0043231	0.831	intracellular membrane-bounded organelle
GO:0016020	0.791	membrane
GO:0062023	0.752	collagen-containing extracellular matrix
GO:0012505	0.663	endomembrane system
GO:0005886	0.333	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]