StarFunc result for job id P01138

User Input

>input (241 residues)
MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIA
ARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSK
RSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCR
DPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRR
A

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P01138	1.000	1.000	9.442E-46	241	1.000	1.000	P01138.pdb.gz	NGF_HUMAN Beta-nerve growth factor OS=Homo sapiens OX=9606 GN=NGF PE=1 SV=3
2	AFDB:P01139	0.458	0.458	3.010E-35	241	0.851	0.851	P01139.pdb.gz	NGF_MOUSE Beta-nerve growth factor OS=Mus musculus OX=10090 GN=Ngf PE=1 SV=2
3	AFDB:P25428	0.624	0.616	2.111E-28	244	0.581	0.574	P25428.pdb.gz	NGFV_MACLB Venom nerve growth factor OS=Macrovipera lebetina OX=8709 PE=1 SV=2
4	AFDB:P18280	0.546	0.511	3.553E-24	258	0.423	0.395	P18280.pdb.gz	NTF3_RAT Neurotrophin-3 OS=Rattus norvegicus OX=10116 GN=Ntf3 PE=2 SV=1
5	AFDB:Q568T2	0.510	0.421	3.386E-20	294	0.382	0.313	Q568T2.pdb.gz
6	AFDB:A0A0B5JS44	0.547	0.674	3.584E-20	194	0.398	0.495	A0A0B5JS44.pdb.gz
7	PDB:4efvB	0.424	0.919	8.119E-18	108	0.432	0.963	4efvB.pdb.gz
8	AFDB:P24727	0.509	0.519	1.580E-17	236	0.369	0.377	P24727.pdb.gz	NTF4_XENLA Neurotrophin-4 OS=Xenopus laevis OX=8355 GN=ntf4 PE=2 SV=1
9	AFDB:P61899	0.427	0.867	3.711E-17	116	0.324	0.672	P61899.pdb.gz	NGFV_NAJKA Venom nerve growth factor OS=Naja kaouthia OX=8649 PE=1 SV=1
10	AFDB:Q6NZ01	0.431	0.387	5.527E-17	270	0.365	0.326	Q6NZ01.pdb.gz	Q6NZ01_DANRE Brain-derived neurotrophic factor OS=Danio rerio OX=7955 GN=bdnf PE=2 SV=1
11	PDB:3ij2A	0.437	0.935	7.058E-17	110	0.415	0.909	3ij2A.pdb.gz
12	AFDB:P21237	0.498	0.483	1.298E-16	249	0.365	0.353	P21237.pdb.gz	BDNF_MOUSE Brain-derived neurotrophic factor OS=Mus musculus OX=10090 GN=Bdnf PE=1 SV=1
13	PDB:2k8pA	0.166	0.193	1.402E-1	189	0.112	0.143	2k8pA.pdb.gz
14	PDB:6hgoC	0.191	0.298	1.484E-1	127	0.079	0.150	6hgoC.pdb.gz
15	PDB:4qhuC	0.222	0.397	1.864E-1	119	0.071	0.143	4qhuC.pdb.gz
16	PDB:5hk5F	0.142	0.217	2.477E-1	129	0.066	0.124	5hk5F.pdb.gz
17	PDB:7uwmA	0.219	0.423	2.477E-1	109	0.091	0.202	7uwmA.pdb.gz
18	PDB:3am2A	0.167	0.148	4.134E-1	286	0.033	0.028	3am2A.pdb.gz
19	PDB:1m4uA	0.208	0.245	7.304E-1	199	0.050	0.060	1m4uA.pdb.gz
20	PDB:4mqwB	0.154	0.278	7.731E-1	109	0.058	0.128	4mqwB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P01138	0.0	503	241	1.000	1.000	NGF_HUMAN Beta-nerve growth factor OS=Homo sapiens OX=9606 GN=NGF PE=1 SV=3
2	P25427	3.99e-158	439	241	0.859	0.859	NGF_RAT Beta-nerve growth factor OS=Rattus norvegicus OX=10116 GN=Ngf PE=2 SV=2
3	P01139	3.07e-156	435	241	0.851	0.851	NGF_MOUSE Beta-nerve growth factor OS=Mus musculus OX=10090 GN=Ngf PE=1 SV=2
4	P25428	6.44e-96	282	244	0.593	0.586	NGFV_MACLB Venom nerve growth factor OS=Macrovipera lebetina OX=8709 PE=1 SV=2
5	J9PBR9	8.54e-81	239	117	0.461	0.949	J9PBR9_LAMGL Ovulation-inducing factor (OIF) OS=Lama glama OX=9844 PE=1 SV=1
6	P20783	6.53e-60	191	257	0.456	0.428	NTF3_HUMAN Neurotrophin-3 OS=Homo sapiens OX=9606 GN=NTF3 PE=1 SV=1
7	P20181	6.14e-59	189	258	0.452	0.422	NTF3_MOUSE Neurotrophin-3 OS=Mus musculus OX=10090 GN=Ntf3 PE=1 SV=1
8	P18280	9.38e-59	188	258	0.452	0.422	NTF3_RAT Neurotrophin-3 OS=Rattus norvegicus OX=10116 GN=Ntf3 PE=2 SV=1
9	P61899	3.63e-55	174	116	0.324	0.672	NGFV_NAJKA Venom nerve growth factor OS=Naja kaouthia OX=8649 PE=1 SV=1
10	A0A0E3SU01	2.96e-40	140	247	0.369	0.360	A0A0E3SU01_HUMAN Brain-derived neurotrophic factor OS=Homo sapiens OX=9606 GN=BDNF PE=2 SV=1
11	P23560	2.96e-40	140	247	0.369	0.360	BDNF_HUMAN Brain-derived neurotrophic factor OS=Homo sapiens OX=9606 GN=BDNF PE=1 SV=1
12	P23363	1.46e-39	139	249	0.369	0.357	BDNF_RAT Brain-derived neurotrophic factor OS=Rattus norvegicus OX=10116 GN=Bdnf PE=2 SV=1
13	P21237	3.45e-39	137	249	0.369	0.357	BDNF_MOUSE Brain-derived neurotrophic factor OS=Mus musculus OX=10090 GN=Bdnf PE=1 SV=1
14	P24727	1.64e-38	135	236	0.311	0.318	NTF4_XENLA Neurotrophin-4 OS=Xenopus laevis OX=8355 GN=ntf4 PE=2 SV=1
15	Q4JHT7	2.72e-37	132	246	0.365	0.358	Q4JHT7_TAEGU Brain-derived neurotrophic factor OS=Taeniopygia guttata OX=59729 GN=BDNF PE=2 SV=1
16	K4MNE5	5.75e-37	132	246	0.369	0.362	K4MNE5_CHICK Brain-derived neurotrophic factor OS=Gallus gallus OX=9031 GN=BDNF PE=2 SV=1
17	P25429	5.75e-37	132	246	0.369	0.362	BDNF_CHICK Brain-derived neurotrophic factor OS=Gallus gallus OX=9031 GN=BDNF PE=2 SV=2
18	K4MQC6	6.68e-37	132	246	0.369	0.362	K4MQC6_CHICK Brain-derived neurotrophic factor OS=Gallus gallus OX=9031 GN=BDNF PE=2 SV=1
19	Q6NZ01	2.35e-36	131	270	0.278	0.248	Q6NZ01_DANRE Brain-derived neurotrophic factor OS=Danio rerio OX=7955 GN=bdnf PE=2 SV=1
20	P34130	1.33e-33	122	210	0.320	0.367	NTF4_HUMAN Neurotrophin-4 OS=Homo sapiens OX=9606 GN=NTF4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00243 NGF	3.2e-49	177.2	Nerve growth factor family
2	PF19338 NTF3_N	1.9e+02	13.8	Neutrophin-3 N-terminus
3	PF16077 Spaetzle	2.3	20.1	Spaetzle

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358525

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000172229	0.999	Tumor necrosis factor receptor superfamily member 16
2	9606.ENSP00000256637	0.999	Sortilin
3	9606.ENSP00000431418	0.999	High affinity nerve growth factor receptor
4	9606.ENSP00000277120	0.992	BDNF/NT-3 growth factors receptor
5	9606.ENSP00000401303	0.975	SHC-transforming protein 1
6	9606.ENSP00000354207	0.971	NT-3 growth factor receptor
7	9606.ENSP00000244007	0.967	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
8	9606.ENSP00000340944	0.967	Tyrosine-protein phosphatase non-receptor type 11
9	9606.ENSP00000311032	0.966	Caspase-3
10	9606.ENSP00000263025	0.964	Mitogen-activated protein kinase 3
11	9606.ENSP00000364995	0.961	SHC-transforming protein 3
12	9606.ENSP00000376345	0.960	Growth factor receptor-bound protein 2
13	9606.ENSP00000308938	0.958	Plasminogen
14	9606.ENSP00000260227	0.954	Matrilysin
15	9606.ENSP00000307786	0.954	Cytochrome c
16	9606.ENSP00000326366	0.952	Presenilin-1
17	9606.ENSP00000400175	0.951	Transforming protein RhoA
18	9606.ENSP00000264657	0.950	Signal transducer and activator of transcription 3
19	9606.ENSP00000407586	0.950	GTPase HRas
20	9606.ENSP00000447241	0.950	Fibroblast growth factor receptor substrate 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0048018	0.996	receptor ligand activity
GO:0030234	0.984	enzyme regulator activity
GO:0008047	0.890	enzyme activator activity
GO:0005126	0.791	cytokine receptor binding
GO:0008083	0.332	growth factor activity
GO:0061134	0.317	peptidase regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.997	regulation of cellular process
GO:0050896	0.993	response to stimulus
GO:0048518	0.993	positive regulation of biological process
GO:0007399	0.987	nervous system development
GO:0019222	0.985	regulation of metabolic process
GO:0048522	0.980	positive regulation of cellular process
GO:0007165	0.980	signal transduction
GO:0060255	0.979	regulation of macromolecule metabolic process
GO:0031323	0.967	regulation of cellular metabolic process
GO:0080090	0.966	regulation of primary metabolic process
GO:0051171	0.966	regulation of nitrogen compound metabolic process
GO:0009893	0.958	positive regulation of metabolic process
GO:0010646	0.954	regulation of cell communication
GO:0010604	0.949	positive regulation of macromolecule metabolic process
GO:0010941	0.948	regulation of cell death
GO:0048519	0.945	negative regulation of biological process
GO:0023051	0.935	regulation of signaling
GO:0007166	0.932	cell surface receptor signaling pathway
GO:0065009	0.928	regulation of molecular function
GO:0044093	0.922	positive regulation of molecular function
GO:0051247	0.919	positive regulation of protein metabolic process
GO:0043067	0.908	regulation of programmed cell death
GO:0008219	0.907	cell death
GO:0006915	0.903	apoptotic process
GO:0048523	0.899	negative regulation of cellular process
GO:0070997	0.892	neuron death
GO:0050793	0.892	regulation of developmental process
GO:0016043	0.887	cellular component organization
GO:0042981	0.887	regulation of apoptotic process
GO:0060548	0.885	negative regulation of cell death
GO:0010468	0.879	regulation of gene expression
GO:0045595	0.873	regulation of cell differentiation
GO:0043085	0.870	positive regulation of catalytic activity
GO:0051094	0.865	positive regulation of developmental process
GO:0043069	0.858	negative regulation of programmed cell death
GO:0048583	0.854	regulation of response to stimulus
GO:0051345	0.848	positive regulation of hydrolase activity
GO:0042127	0.845	regulation of cell population proliferation
GO:0009966	0.844	regulation of signal transduction
GO:0030154	0.842	cell differentiation
GO:0009653	0.829	anatomical structure morphogenesis
GO:0048468	0.811	cell development
GO:0043066	0.802	negative regulation of apoptotic process
GO:0052547	0.769	regulation of peptidase activity
GO:0045597	0.767	positive regulation of cell differentiation
GO:0051402	0.757	neuron apoptotic process
GO:0048699	0.743	generation of neurons
GO:0000902	0.725	cell morphogenesis
GO:1901214	0.725	regulation of neuron death
GO:0030030	0.724	cell projection organization
GO:1901215	0.699	negative regulation of neuron death
GO:0043523	0.677	regulation of neuron apoptotic process
GO:0031325	0.675	positive regulation of cellular metabolic process
GO:0043524	0.674	negative regulation of neuron apoptotic process
GO:0030182	0.672	neuron differentiation
GO:0051128	0.651	regulation of cellular component organization
GO:0097190	0.644	apoptotic signaling pathway
GO:0052548	0.623	regulation of endopeptidase activity
GO:0045862	0.608	positive regulation of proteolysis
GO:0031175	0.606	neuron projection development
GO:0051239	0.600	regulation of multicellular organismal process
GO:0045664	0.588	regulation of neuron differentiation
GO:0097191	0.569	extrinsic apoptotic signaling pathway
GO:0071704	0.567	organic substance metabolic process
GO:0010952	0.555	positive regulation of peptidase activity
GO:0032990	0.550	cell part morphogenesis
GO:0045666	0.524	positive regulation of neuron differentiation
GO:0010950	0.513	positive regulation of endopeptidase activity
GO:0048858	0.509	cell projection morphogenesis
GO:0048812	0.503	neuron projection morphogenesis
GO:0031399	0.500	regulation of protein modification process
GO:2000116	0.496	regulation of cysteine-type endopeptidase activity
GO:0051174	0.493	regulation of phosphorus metabolic process
GO:0006950	0.480	response to stress
GO:0048584	0.470	positive regulation of response to stimulus
GO:0044238	0.465	primary metabolic process
GO:1902531	0.463	regulation of intracellular signal transduction
GO:0042325	0.460	regulation of phosphorylation
GO:0042221	0.440	response to chemical
GO:0051240	0.426	positive regulation of multicellular organismal process
GO:0023056	0.411	positive regulation of signaling
GO:2001056	0.400	positive regulation of cysteine-type endopeptidase activity
GO:0009889	0.398	regulation of biosynthetic process
GO:0048667	0.389	cell morphogenesis involved in neuron differentiation
GO:0061564	0.388	axon development
GO:0006807	0.386	nitrogen compound metabolic process
GO:0010647	0.380	positive regulation of cell communication
GO:0001932	0.380	regulation of protein phosphorylation
GO:0031326	0.369	regulation of cellular biosynthetic process
GO:0009967	0.348	positive regulation of signal transduction
GO:1902533	0.337	positive regulation of intracellular signal transduction
GO:0043170	0.336	macromolecule metabolic process
GO:0043281	0.331	regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0001934	0.327	positive regulation of protein phosphorylation
GO:0010556	0.305	regulation of macromolecule biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.998	extracellular region
GO:0005737	0.998	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0031974	0.997	membrane-enclosed lumen
GO:0012505	0.997	endomembrane system
GO:0070013	0.994	intracellular organelle lumen
GO:0005829	0.974	cytosol
GO:0005615	0.907	extracellular space
GO:0005794	0.658	Golgi apparatus
GO:0005886	0.539	plasma membrane
GO:0005783	0.530	endoplasmic reticulum
GO:0031981	0.370	nuclear lumen
GO:0005788	0.343	endoplasmic reticulum lumen
GO:0005796	0.331	Golgi lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]