StarFunc result for job id P01160

User Input

>input (151 residues)
MSSFSTTTVSFLLLLAFQLLGQTRANPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPP
QVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLT
APRSLRRSSCFGGRMDRIGAQSGLGCNSFRY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P01160	1.000	1.000	1.009E-22	151	1.000	1.000	P01160.pdb.gz	ANF_HUMAN Natriuretic peptides A OS=Homo sapiens OX=9606 GN=NPPA PE=1 SV=2
2	AFDB:P01161	0.348	0.347	3.894E-15	152	0.808	0.803	P01161.pdb.gz	ANF_RAT Natriuretic peptides A OS=Rattus norvegicus OX=10116 GN=Nppa PE=1 SV=1
3	AFDB:Q7SXL7	0.203	0.097	4.547E-1	423	0.159	0.057	Q7SXL7.pdb.gz	FL2D_DANRE Pre-mRNA-splicing regulator WTAP OS=Danio rerio OX=7955 GN=wtap PE=2 SV=1
4	AFDB:A0A024RB29	0.174	0.155	5.238E-1	177	0.212	0.181	A0A024RB29.pdb.gz
5	AFDB:P53207	0.133	0.043	5.238E-1	620	0.099	0.024	P53207.pdb.gz	SNU71_YEAST U1 small nuclear ribonucleoprotein component SNU71 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SNU71 PE=1 SV=1
6	AFDB:P34611	0.187	0.052	6.476E-1	851	0.166	0.029	P34611.pdb.gz	NCL1_CAEEL B-box type zinc finger protein ncl-1 OS=Caenorhabditis elegans OX=6239 GN=ncl-1 PE=2 SV=1
7	AFDB:Q6P110	0.180	0.130	6.950E-1	231	0.192	0.126	Q6P110.pdb.gz	Q6P110_DANRE INO80 complex subunit E OS=Danio rerio OX=7955 GN=si:ch73-54f23.2 PE=2 SV=1
8	AFDB:Q640R3	0.212	0.102	9.899E-1	418	0.152	0.055	Q640R3.pdb.gz	HECAM_MOUSE Hepatic and glial cell adhesion molecule OS=Mus musculus OX=10090 GN=Hepacam PE=1 SV=2
9	AFDB:Q9NVM1	0.142	0.131	1.062	165	0.205	0.188	Q9NVM1.pdb.gz	EVA1B_HUMAN Protein eva-1 homolog B OS=Homo sapiens OX=9606 GN=EVA1B PE=1 SV=1
10	AFDB:Q54LV6	0.168	0.108	1.513	280	0.139	0.075	Q54LV6.pdb.gz	Y6946_DICDI Uncharacterized protein DDB_G0286393 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0286393 PE=4 SV=1
11	PDB:7r5jV0	0.150	0.095	7.059	273	0.166	0.092	7r5jV0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
12	PDB:6wj2A	0.152	0.224	7.577	96	0.099	0.156	6wj2A.pdb.gz	Structural mechanism for amino acid-dependent Rag GTPase nucleotide state switching by SLC38A9.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P01160	2.70e-108	306	151	1.000	1.000	ANF_HUMAN Natriuretic peptides A OS=Homo sapiens OX=9606 GN=NPPA PE=1 SV=2
2	P01161	2.74e-84	246	152	0.808	0.803	ANF_RAT Natriuretic peptides A OS=Rattus norvegicus OX=10116 GN=Nppa PE=1 SV=1
3	P05125	1.65e-82	241	152	0.801	0.796	ANF_MOUSE Natriuretic peptides A OS=Mus musculus OX=10090 GN=Nppa PE=1 SV=2
4	P18908	4.49e-12	61.6	140	0.305	0.329	ANF_CHICK Natriuretic peptides A OS=Gallus gallus OX=9031 GN=NPPA PE=1 SV=2
5	Q9YGJ1	1.74e-09	55.1	152	0.305	0.303	Q9YGJ1_SALSA Cardiac hormone OS=Salmo salar OX=8030 GN=LOC100136387 PE=2 SV=1
6	Q78AW6	1.82e-09	55.1	148	0.305	0.311	Q78AW6_SALSA Cardiac peptide OS=Salmo salar OX=8030 PE=3 SV=1
7	F1QVW0	1.83e-07	49.7	139	0.265	0.288	F1QVW0_DANRE Natriuretic peptide A OS=Danio rerio OX=7955 GN=anf PE=1 SV=1
8	F1R8L8	1.26e-06	47.0	129	0.278	0.326	F1R8L8_DANRE Natriuretic peptide B OS=Danio rerio OX=7955 GN=si:ch211-215j19.10 PE=3 SV=1
9	A0A060W032	4.21e-05	43.1	149	0.219	0.221	A0A060W032_ONCMY Ventricular natriuretic peptide OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00081842001 PE=3 SV=1
10	P82972	1.05e-04	39.7	37	0.099	0.405	VNP_PSEPC Natriuretic peptide PNP OS=Pseudocerastes persicus OX=47769 PE=1 SV=1
11	Q7T2I6	1.45e-04	42.0	149	0.212	0.215	Q7T2I6_ONCMY Ventricular natriuretic peptide OS=Oncorhynchus mykiss OX=8022 GN=vnp PE=2 SV=1
12	A0A060XWG0	0.002	38.5	131	0.219	0.252	A0A060XWG0_ONCMY C-type natriuretic peptide 1 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00030908001 PE=3 SV=1
13	P40753	0.002	38.1	121	0.093	0.116	ANFB_MOUSE Natriuretic peptides B OS=Mus musculus OX=10090 GN=Nppb PE=1 SV=2
14	Q8AXR3	0.002	38.5	131	0.219	0.252	ANFC1_ONCMY C-type natriuretic peptide 1 OS=Oncorhynchus mykiss OX=8022 GN=cnp-1 PE=2 SV=1
15	P16860	0.003	38.1	134	0.126	0.142	ANFB_HUMAN Natriuretic peptides B OS=Homo sapiens OX=9606 GN=NPPB PE=1 SV=1
16	P13205	0.004	37.4	121	0.152	0.190	ANFB_RAT Natriuretic peptides B OS=Rattus norvegicus OX=10116 GN=Nppb PE=1 SV=3
17	B3EWY3	0.012	34.3	32	0.086	0.406	BNPL1_CROOA Natriuretic peptide Coa_NP1 OS=Crotalus oreganus abyssus OX=128077 PE=1 SV=1
18	D9IX97	0.019	36.2	165	0.086	0.079	VNP_NAJAT Natriuretic peptide Na-NP OS=Naja atra OX=8656 PE=1 SV=1
19	B3EWY2	0.029	33.1	32	0.086	0.406	BNPL2_CROOA Natriuretic peptide Coa_NP2 OS=Crotalus oreganus abyssus OX=128077 PE=1 SV=1
20	Q27J49	0.19	33.5	239	0.079	0.050	BNP_LACMU Bradykinin-potentiating and C-type natriuretic peptides OS=Lachesis muta muta OX=8753 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00212 ANP	6.9e-08	43.9	Atrial natriuretic peptide

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000365663

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265074	0.999	Atrial natriuretic peptide receptor 3
2	9606.ENSP00000357669	0.999	Atrial natriuretic peptide receptor 1
3	9606.ENSP00000341083	0.994	Atrial natriuretic peptide receptor 2
4	9606.ENSP00000334458	0.973	Transcription factor GATA-4
5	9606.ENSP00000273857	0.971	Atrial natriuretic peptide-converting enzyme
6	9606.ENSP00000327758	0.970	Homeobox protein Nkx-2.5
7	9606.ENSP00000309913	0.965	T-box transcription factor TBX5
8	9606.ENSP00000340874	0.954	Myocyte-specific enhancer factor 2C
9	9606.ENSP00000419465	0.942	WW domain-containing transcription regulator protein 1
10	9606.ENSP00000365651	0.925	Natriuretic peptides B
11	9606.ENSP00000389377	0.917	Nuclear factor of activated T-cells, cytoplasmic 1
12	9606.ENSP00000264110	0.906	Cyclic AMP-dependent transcription factor ATF-2
13	9606.ENSP00000263754	0.900	Histone acetyltransferase KAT2B
14	9606.ENSP00000358571	0.900	Homeodomain-interacting protein kinase 1
15	9606.ENSP00000385571	0.900	Homeodomain-interacting protein kinase 2
16	9606.ENSP00000347507	0.843	Myosin-7
17	9606.ENSP00000387159	0.842	C-type natriuretic peptide
18	9606.ENSP00000265986	0.835	Insulin-degrading enzyme
19	9606.ENSP00000386041	0.814	Myosin-6
20	9606.ENSP00000394842	0.795	Grancalcin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005179	1.000	hormone activity
GO:0051427	0.957	hormone receptor binding
GO:0005184	0.944	neuropeptide hormone activity
GO:0071855	0.908	neuropeptide receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.977	multicellular organismal process
GO:0050789	0.977	regulation of biological process
GO:0050896	0.974	response to stimulus
GO:0009987	0.973	cellular process
GO:0050794	0.967	regulation of cellular process
GO:0008217	0.967	regulation of blood pressure
GO:0003012	0.955	muscle system process
GO:0023051	0.948	regulation of signaling
GO:0032502	0.927	developmental process
GO:0010646	0.922	regulation of cell communication
GO:0051716	0.921	cellular response to stimulus
GO:0007154	0.916	cell communication
GO:0048856	0.907	anatomical structure development
GO:0071704	0.906	organic substance metabolic process
GO:0048518	0.902	positive regulation of biological process
GO:0007275	0.902	multicellular organism development
GO:0051239	0.900	regulation of multicellular organismal process
GO:0048519	0.898	negative regulation of biological process
GO:0023052	0.895	signaling
GO:0044238	0.888	primary metabolic process
GO:0044237	0.886	cellular metabolic process
GO:0048523	0.884	negative regulation of cellular process
GO:0044093	0.881	positive regulation of molecular function
GO:0044057	0.881	regulation of system process
GO:0048522	0.876	positive regulation of cellular process
GO:0007165	0.858	signal transduction
GO:0006807	0.837	nitrogen compound metabolic process
GO:0048583	0.835	regulation of response to stimulus
GO:0032879	0.829	regulation of localization
GO:0048731	0.828	system development
GO:0051241	0.824	negative regulation of multicellular organismal process
GO:1901564	0.818	organonitrogen compound metabolic process
GO:0051049	0.813	regulation of transport
GO:0003018	0.793	vascular process in circulatory system
GO:0051179	0.784	localization
GO:0019222	0.775	regulation of metabolic process
GO:0097746	0.762	blood vessel diameter maintenance
GO:0051234	0.759	establishment of localization
GO:0043270	0.753	positive regulation of monoatomic ion transport
GO:0006810	0.752	transport
GO:0090257	0.746	regulation of muscle system process
GO:0060255	0.745	regulation of macromolecule metabolic process
GO:0034767	0.744	positive regulation of monoatomic ion transmembrane transport
GO:0048513	0.728	animal organ development
GO:0014896	0.719	muscle hypertrophy
GO:1904064	0.718	positive regulation of cation transmembrane transport
GO:0010959	0.706	regulation of metal ion transport
GO:0032409	0.684	regulation of transporter activity
GO:0006937	0.668	regulation of muscle contraction
GO:0042311	0.658	vasodilation
GO:0003300	0.656	cardiac muscle hypertrophy
GO:0022898	0.656	regulation of transmembrane transporter activity
GO:0051171	0.653	regulation of nitrogen compound metabolic process
GO:0009628	0.640	response to abiotic stimulus
GO:0031323	0.640	regulation of cellular metabolic process
GO:0009605	0.639	response to external stimulus
GO:0006940	0.637	regulation of smooth muscle contraction
GO:0009966	0.633	regulation of signal transduction
GO:0080090	0.623	regulation of primary metabolic process
GO:0032412	0.623	regulation of monoatomic ion transmembrane transporter activity
GO:0006796	0.621	phosphate-containing compound metabolic process
GO:0009187	0.613	cyclic nucleotide metabolic process
GO:0009190	0.601	cyclic nucleotide biosynthetic process
GO:0052652	0.598	cyclic purine nucleotide metabolic process
GO:0043266	0.582	regulation of potassium ion transport
GO:0072359	0.570	circulatory system development
GO:1901379	0.562	regulation of potassium ion transmembrane transport
GO:0009612	0.552	response to mechanical stimulus
GO:1901016	0.543	regulation of potassium ion transmembrane transporter activity
GO:0051240	0.412	positive regulation of multicellular organismal process
GO:0006950	0.406	response to stress
GO:0042221	0.372	response to chemical
GO:0007507	0.352	heart development
GO:0009892	0.349	negative regulation of metabolic process
GO:1902531	0.347	regulation of intracellular signal transduction
GO:0009893	0.331	positive regulation of metabolic process
GO:0051246	0.327	regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0005737	0.999	cytoplasm
GO:0071944	0.996	cell periphery
GO:0032991	0.974	protein-containing complex
GO:0043229	0.936	intracellular organelle
GO:0043227	0.934	membrane-bounded organelle
GO:0005615	0.879	extracellular space
GO:0016020	0.868	membrane
GO:0043231	0.808	intracellular membrane-bounded organelle
GO:0031012	0.679	extracellular matrix
GO:0062023	0.561	collagen-containing extracellular matrix
GO:0005886	0.507	plasma membrane
GO:0070013	0.444	intracellular organelle lumen
GO:0048471	0.387	perinuclear region of cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]