StarFunc result for job id P01185

User Input

>input (164 residues)
MPDTMLPACFLGLLAFSSACYFQNCPRGGKRAMSDLELRQCLPCGPGGKGRCFGPSICCA
DELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAAFGVCCNDESCVTEPECREGF
HRRARASDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P01185	1.000	1.000	1.298E-33	164	1.000	1.000	P01185.pdb.gz	NEU2_HUMAN Vasopressin-neurophysin 2-copeptin OS=Homo sapiens OX=9606 GN=AVP PE=1 SV=2
2	AFDB:P01186	0.736	0.720	5.216E-27	168	0.799	0.780	P01186.pdb.gz	NEU2_RAT Vasopressin-neurophysin 2-copeptin OS=Rattus norvegicus OX=10116 GN=Avp PE=1 SV=1
3	AFDB:P01178	0.696	0.902	3.291E-20	125	0.530	0.696	P01178.pdb.gz	NEU1_HUMAN Oxytocin-neurophysin 1 OS=Homo sapiens OX=9606 GN=OXT PE=1 SV=1
4	AFDB:P01175	0.624	0.797	1.358E-19	125	0.537	0.704	P01175.pdb.gz	NEU1_BOVIN Oxytocin-neurophysin 1 OS=Bos taurus OX=9913 GN=OXT PE=1 SV=1
5	AFDB:B9VJ17	0.496	0.686	1.788E-18	117	0.463	0.650	B9VJ17.pdb.gz	B9VJ17_ONCMY Arginine vasotocin (Fragment) OS=Oncorhynchus mykiss OX=8022 PE=2 SV=3
6	AFDB:F1QC27	0.519	0.551	7.870E-18	154	0.470	0.500	F1QC27.pdb.gz
7	AFDB:Q8AV79	0.508	0.555	4.276E-16	149	0.482	0.530	Q8AV79.pdb.gz	Q8AV79_DANRE Vasopressin-neurophysin 2-copeptin precursor OS=Danio rerio OX=7955 GN=avpl PE=2 SV=1
8	AFDB:Q8TF50	0.159	0.061	4.855E-1	670	0.171	0.042	Q8TF50.pdb.gz	ZN526_HUMAN Zinc finger protein 526 OS=Homo sapiens OX=9606 GN=ZNF526 PE=1 SV=2
9	AFDB:O30434	0.124	0.254	2.004	71	0.073	0.169	O30434.pdb.gz	ETCP_ENTFC Bacteriocin enterocin-P OS=Enterococcus faecium OX=1352 GN=entP PE=1 SV=1
10	AFDB:Q6P0F9	0.119	0.070	2.950	383	0.128	0.055	Q6P0F9.pdb.gz	INS1A_DANRE Insulinoma-associated protein 1a OS=Danio rerio OX=7955 GN=insm1a PE=2 SV=1
11	PDB:2mpmA	0.121	0.204	5.194	74	0.055	0.122	2mpmA.pdb.gz	Structural Basis of Receptor Sulfotyrosine Recognition by a CC Chemokine: The N-Terminal Region of CCR3 Bound to CCL11/Eotaxin-1.
12	PDB:7mqaNA	0.124	0.084	5.908	295	0.134	0.075	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:6drvA	0.123	0.030	6.301	1024	0.024	0.004	6drvA.pdb.gz
14	PDB:2vk1A	0.109	0.037	6.721	562	0.043	0.012	2vk1A.pdb.gz	Covalently Bound Substrate at the Regulatory Site of Yeast Pyruvate Decarboxylases Triggers Allosteric Enzyme Activation.
15	PDB:6rlbC	0.078	0.032	6.721	494	0.067	0.022	6rlbC.pdb.gz
16	PDB:5aj0Ap	0.152	0.226	7.168	91	0.055	0.099	5aj0Ap.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
17	PDB:4v96Bd	0.102	0.102	8.154	165	0.061	0.061	4v96Bd.pdb.gz
18	PDB:1b8tA	0.097	0.091	8.697	192	0.085	0.073	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
19	PDB:5iy7M	0.117	0.072	8.697	310	0.128	0.068	5iy7M.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
20	PDB:6kjvB	0.173	0.087	8.697	424	0.098	0.038	6kjvB.pdb.gz	Mutagenesis facilitated crystallization of GLP-1R.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P01185	2.25e-115	325	164	1.000	1.000	NEU2_HUMAN Vasopressin-neurophysin 2-copeptin OS=Homo sapiens OX=9606 GN=AVP PE=1 SV=2
2	P35455	1.48e-92	268	168	0.817	0.798	NEU2_MOUSE Vasopressin-neurophysin 2-copeptin OS=Mus musculus OX=10090 GN=Avp PE=2 SV=1
3	P01186	1.05e-91	265	168	0.805	0.786	NEU2_RAT Vasopressin-neurophysin 2-copeptin OS=Rattus norvegicus OX=10116 GN=Avp PE=1 SV=1
4	P35454	6.01e-54	168	125	0.500	0.656	NEU1_MOUSE Oxytocin-neurophysin 1 OS=Mus musculus OX=10090 GN=Oxt PE=2 SV=1
5	P01179	5.30e-53	166	125	0.494	0.648	NEU1_RAT Oxytocin-neurophysin 1 OS=Rattus norvegicus OX=10116 GN=Oxt PE=1 SV=2
6	P01175	2.48e-52	164	125	0.488	0.640	NEU1_BOVIN Oxytocin-neurophysin 1 OS=Bos taurus OX=9913 GN=OXT PE=1 SV=1
7	P01178	2.98e-52	164	125	0.482	0.632	NEU1_HUMAN Oxytocin-neurophysin 1 OS=Homo sapiens OX=9606 GN=OXT PE=1 SV=1
8	B9VJ17	1.84e-41	136	117	0.433	0.607	B9VJ17_ONCMY Arginine vasotocin (Fragment) OS=Oncorhynchus mykiss OX=8022 PE=2 SV=3
9	Q8AV79	5.34e-41	136	149	0.476	0.523	Q8AV79_DANRE Vasopressin-neurophysin 2-copeptin precursor OS=Danio rerio OX=7955 GN=avpl PE=2 SV=1
10	Q8UUT8	1.09e-39	133	154	0.390	0.416	Q8UUT8_DANRE Isotocin OS=Danio rerio OX=7955 GN=IT-NP PE=2 SV=1
11	F1SWA3	6.56e-39	129	85	0.390	0.753	F1SWA3_BOVIN Oxytocin (Fragment) OS=Bos taurus OX=9913 GN=OXT PE=3 SV=1
12	Q9WTS5	1.4	31.6	2764	0.152	0.009	TEN2_MOUSE Teneurin-2 OS=Mus musculus OX=10090 GN=Tenm2 PE=1 SV=1
13	Q9R1K2	1.5	31.6	2774	0.152	0.009	TEN2_RAT Teneurin-2 OS=Rattus norvegicus OX=10116 GN=Tenm2 PE=1 SV=2
14	Q9NT68	2.1	31.2	2774	0.165	0.010	TEN2_HUMAN Teneurin-2 OS=Homo sapiens OX=9606 GN=TENM2 PE=1 SV=3
15	Q381U1	3.4	30.4	539	0.122	0.037	Q381U1_TRYB2 tRNA/rRNA methyltransferase SpoU type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.6580 PE=4 SV=1
16	Q3UHK6	4.5	30.0	2771	0.159	0.009	TEN4_MOUSE Teneurin-4 OS=Mus musculus OX=10090 GN=Tenm4 PE=1 SV=2
17	Q6N022	4.6	30.0	2769	0.159	0.009	TEN4_HUMAN Teneurin-4 OS=Homo sapiens OX=9606 GN=TENM4 PE=1 SV=2
18	E2RUH0	6.8	29.6	859	0.159	0.030	E2RUH0_CHICK Ectonucleotide pyrophosphatase/phosphodiesterase 2, long form OS=Gallus gallus OX=9031 GN=Enpp2 PE=2 SV=1
19	O97302	10.0	28.9	1086	0.116	0.017	RH5IP_PLAF7 Rh5-interacting protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RIPR PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00220 Hormone_4	0.23	22.3	Neurohypophysial hormones, N-terminal Domain
2	PF00184 Hormone_5	4e-23	93.4	Neurohypophysial hormones, C-terminal Domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000369647

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351805	0.998	Vasopressin V2 receptor
2	9606.ENSP00000299178	0.965	Vasopressin V1a receptor
3	9606.ENSP00000356094	0.930	Vasopressin V1b receptor
4	9606.ENSP00000384517	0.921	Aryl hydrocarbon receptor nuclear translocator-like protein 1
5	9606.ENSP00000308741	0.920	Circadian locomoter output cycles protein kaput
6	9606.ENSP00000324270	0.909	Oxytocin receptor
7	9606.ENSP00000338283	0.906	Neuronal PAS domain-containing protein 2
8	9606.ENSP00000320634	0.902	Solute carrier organic anion transporter family member 3A1
9	9606.ENSP00000312262	0.901	Beta-adrenergic receptor kinase 1
10	9606.ENSP00000317578	0.900	Beta-adrenergic receptor kinase 2
11	9606.ENSP00000345195	0.900	Ubiquilin-2
12	9606.ENSP00000217386	0.878	Oxytocin-neurophysin 1
13	9606.ENSP00000306606	0.870	Alcohol dehydrogenase 1B, beta polypeptide
14	9606.ENSP00000265634	0.859	Neuronal pentraxin-2
15	9606.ENSP00000426083	0.859	Alcohol dehydrogenase 1C, gamma polypeptide
16	9606.ENSP00000265512	0.858	Alcohol dehydrogenase 4, pi polypeptide
17	9606.ENSP00000296412	0.853	Alcohol dehydrogenase class-3
18	9606.ENSP00000272190	0.845	Renin
19	9606.ENSP00000199280	0.844	Aquaporin-2
20	9606.ENSP00000436607	0.835	ADM

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0001664	0.999	G protein-coupled receptor binding
GO:0005184	0.999	neuropeptide hormone activity
GO:0003824	0.963	catalytic activity
GO:0031894	0.941	V1A vasopressin receptor binding
GO:0061134	0.843	peptidase regulator activity
GO:0043028	0.811	cysteine-type endopeptidase regulator activity involved in apoptotic process
GO:0004869	0.805	cysteine-type endopeptidase inhibitor activity
GO:0016740	0.783	transferase activity
GO:0140096	0.773	catalytic activity, acting on a protein
GO:0043027	0.771	cysteine-type endopeptidase inhibitor activity involved in apoptotic process
GO:0016773	0.756	phosphotransferase activity, alcohol group as acceptor
GO:0016301	0.756	kinase activity
GO:0004672	0.702	protein kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0050794	0.993	regulation of cellular process
GO:0050896	0.991	response to stimulus
GO:0019222	0.969	regulation of metabolic process
GO:0009987	0.958	cellular process
GO:0048518	0.934	positive regulation of biological process
GO:0048522	0.879	positive regulation of cellular process
GO:0048519	0.876	negative regulation of biological process
GO:0060255	0.857	regulation of macromolecule metabolic process
GO:0010646	0.844	regulation of cell communication
GO:0080090	0.834	regulation of primary metabolic process
GO:0009893	0.815	positive regulation of metabolic process
GO:0048523	0.804	negative regulation of cellular process
GO:0031323	0.797	regulation of cellular metabolic process
GO:0051716	0.753	cellular response to stimulus
GO:0007154	0.727	cell communication
GO:0023052	0.726	signaling
GO:0009966	0.715	regulation of signal transduction
GO:0031325	0.694	positive regulation of cellular metabolic process
GO:0051171	0.685	regulation of nitrogen compound metabolic process
GO:0050790	0.681	regulation of catalytic activity
GO:0051173	0.614	positive regulation of nitrogen compound metabolic process
GO:0051246	0.605	regulation of protein metabolic process
GO:0007165	0.605	signal transduction
GO:0010604	0.601	positive regulation of macromolecule metabolic process
GO:0032501	0.580	multicellular organismal process
GO:0051128	0.551	regulation of cellular component organization
GO:0008152	0.475	metabolic process
GO:0051179	0.464	localization
GO:0065008	0.415	regulation of biological quality
GO:0044237	0.389	cellular metabolic process
GO:0051239	0.359	regulation of multicellular organismal process
GO:0042221	0.320	response to chemical
GO:0009892	0.302	negative regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0005622	0.964	intracellular anatomical structure
GO:0005737	0.942	cytoplasm
GO:0043226	0.938	organelle
GO:0043231	0.934	intracellular membrane-bounded organelle
GO:0031982	0.881	vesicle
GO:0071944	0.866	cell periphery
GO:0005886	0.855	plasma membrane
GO:0031410	0.787	cytoplasmic vesicle
GO:0005615	0.704	extracellular space
GO:0070013	0.431	intracellular organelle lumen
GO:0005829	0.409	cytosol
GO:0012505	0.385	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.783	Transferases.
EC:2.7.1.-	0.756	Phosphotransferases with an alcohol group as acceptor.

[back to server]