StarFunc result for job id P01189

User Input

>input (267 residues)
MPRSCCSRSGALLLALLLQASMEVRGWCLESSQCQDLTTESNLLECIRACKPDLSAETPM
FPGNGDEQPLTENPRKYVMGHFRWDRFGRRNSSSSGSSGAGQKREDVSAGEDCGPLPEGG
PEPRSDGAKPGPREGKRSYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEFKREL
TGQRLREGDGPDGPADDGAGAQADLEHSLLVAAEKKDEGPYRMEHFRWGSPPKDKRYGGF
MTSEKSQTPLVTLFKNAIIKNAYKKGE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P01189	1.000	1.000	1.453E-41	267	1.000	1.000	P01189.pdb.gz	COLI_HUMAN Pro-opiomelanocortin OS=Homo sapiens OX=9606 GN=POMC PE=1 SV=2
2	AFDB:P01192	0.555	0.555	3.964E-28	267	0.801	0.801	P01192.pdb.gz	COLI_PIG Pro-opiomelanocortin OS=Sus scrofa OX=9823 GN=POMC PE=1 SV=1
3	AFDB:P01193	0.225	0.248	3.341E-25	235	0.704	0.800	P01193.pdb.gz	COLI_MOUSE Pro-opiomelanocortin OS=Mus musculus OX=10090 GN=Pomc PE=1 SV=1
4	AFDB:O14503	0.112	0.077	1.725	412	0.139	0.090	O14503.pdb.gz	BHE40_HUMAN Class E basic helix-loop-helix protein 40 OS=Homo sapiens OX=9606 GN=BHLHE40 PE=1 SV=1
5	AFDB:A0A096MIY8	0.104	0.107	2.240	259	0.142	0.147	A0A096MIY8.pdb.gz	A0A096MIY8_RAT Aspartate-beta-hydroxylase OS=Rattus norvegicus OX=10116 GN=Asph PE=1 SV=1
6	AFDB:P56672	0.095	0.078	2.910	409	0.154	0.100	P56672.pdb.gz	OTP_DROME Homeobox protein orthopedia OS=Drosophila melanogaster OX=7227 GN=otp PE=2 SV=2
7	AFDB:Q93WU6	0.091	0.077	3.107	330	0.139	0.112	Q93WU6.pdb.gz	WRK74_ARATH Probable WRKY transcription factor 74 OS=Arabidopsis thaliana OX=3702 GN=WRKY74 PE=2 SV=2
8	PDB:2bskD	0.148	0.317	3.306	90	0.045	0.133	2bskD.pdb.gz
9	AFDB:A0A1D8PDR2	0.104	0.080	3.541	367	0.109	0.079	A0A1D8PDR2.pdb.gz	A0A1D8PDR2_CANAL Transcription factor OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HAC1 PE=3 SV=1
10	AFDB:Q0D311	0.124	0.088	3.541	403	0.131	0.087	Q0D311.pdb.gz	Q0D311_DANRE Basic-helix-loop-helix protein OS=Danio rerio OX=7955 GN=dec1 PE=2 SV=1
11	AFDB:Q6P4E1	0.132	0.091	3.781	436	0.139	0.085	Q6P4E1.pdb.gz	GOLM2_HUMAN Protein GOLM2 OS=Homo sapiens OX=9606 GN=GOLM2 PE=1 SV=2
12	PDB:6bk8K	0.134	0.335	5.578	82	0.037	0.122	6bk8K.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
13	PDB:7c4jH	0.120	0.130	6.358	242	0.064	0.070	7c4jH.pdb.gz
14	PDB:3jb9M	0.081	0.101	7.736	207	0.049	0.063	3jb9M.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
15	PDB:1xdxA	0.091	0.166	8.259	114	0.030	0.070	1xdxA.pdb.gz
16	PDB:6t9iI	0.134	0.188	8.259	173	0.034	0.052	6t9iI.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P01189	0.0	546	267	1.000	1.000	COLI_HUMAN Pro-opiomelanocortin OS=Homo sapiens OX=9606 GN=POMC PE=1 SV=2
2	P01192	2.50e-124	356	267	0.779	0.779	COLI_PIG Pro-opiomelanocortin OS=Sus scrofa OX=9823 GN=POMC PE=1 SV=1
3	P01194	9.57e-121	346	235	0.719	0.817	COLI_RAT Pro-opiomelanocortin OS=Rattus norvegicus OX=10116 GN=Pomc PE=1 SV=1
4	P01193	2.15e-120	345	235	0.719	0.817	COLI_MOUSE Pro-opiomelanocortin OS=Mus musculus OX=10090 GN=Pomc PE=1 SV=1
5	Q7ZT12	4.55e-57	183	212	0.397	0.500	Q7ZT12_ICTPU Proopiomelanocortin OS=Ictalurus punctatus OX=7998 GN=POMC PE=2 SV=1
6	Q7ZT18	1.77e-54	177	222	0.408	0.491	Q7ZT18_DANRE Pro-opiomelanocortin precursor OS=Danio rerio OX=7955 GN=pomc PE=2 SV=1
7	Q38FS0	4.1	31.2	757	0.090	0.032	Q38FS0_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.1160 PE=4 SV=1
8	Q8IK84	6.4	30.8	5906	0.064	0.003	Q8IK84_PLAF7 Cysteine repeat modular protein 4 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1475400 PE=4 SV=2
9	A8E7N7	9.5	30.4	1277	0.112	0.023	A8E7N7_DANRE Pogo transposable element-derived with ZNF domain a OS=Danio rerio OX=7955 GN=im:7136628 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16102 ACTH_assoc	7.6	18.6	ACTH-associated domain
2	PF00976 ACTH_domain	9.6e-23	91.0	Corticotropin ACTH domain
3	PF08384 NPP	1.6e-16	71.3	Pro-opiomelanocortin, N-terminal region
4	PF08035 Op_neuropeptide	1.1e-11	55.6	Opioids neuropeptide

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384092

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000299766	0.999	Melanocortin receptor 4
2	9606.ENSP00000333821	0.998	Adrenocorticotropic hormone receptor
3	9606.ENSP00000451605	0.998	Melanocyte-stimulating hormone receptor
4	9606.ENSP00000243911	0.997	Melanocortin receptor 3
5	9606.ENSP00000394624	0.997	Mu-type opioid receptor
6	9606.ENSP00000290953	0.995	Agouti-related protein
7	9606.ENSP00000318077	0.987	Melanocortin receptor 5
8	9606.ENSP00000440185	0.974	Proenkephalin-B
9	9606.ENSP00000385675	0.967	Interleukin-6
10	9606.ENSP00000308024	0.966	Neuroendocrine convertase 1
11	9606.ENSP00000295897	0.963	Serum albumin
12	9606.ENSP00000324248	0.962	Proenkephalin-A
13	9606.ENSP00000264498	0.961	Fibroblast growth factor 2
14	9606.ENSP00000264657	0.960	Signal transducer and activator of transcription 3
15	9606.ENSP00000384364	0.960	Pro-neuropeptide Y
16	9606.ENSP00000412237	0.953	Interleukin-10
17	9606.ENSP00000368880	0.950	Forkhead box protein O1
18	9606.ENSP00000276571	0.949	Corticoliberin
19	9606.ENSP00000382684	0.946	Melanocortin-2 receptor accessory protein
20	9606.ENSP00000256592	0.940	Thyrotropin subunit beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005179	1.000	hormone activity
GO:0001664	0.936	G protein-coupled receptor binding
GO:0071855	0.932	neuropeptide receptor binding
GO:0070996	0.734	type 1 melanocortin receptor binding
GO:0031782	0.734	type 4 melanocortin receptor binding
GO:0031781	0.734	type 3 melanocortin receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0009987	0.997	cellular process
GO:0007165	0.992	signal transduction
GO:0032501	0.978	multicellular organismal process
GO:0048522	0.973	positive regulation of cellular process
GO:0010817	0.882	regulation of hormone levels
GO:0048583	0.879	regulation of response to stimulus
GO:0019222	0.878	regulation of metabolic process
GO:0060255	0.855	regulation of macromolecule metabolic process
GO:0009893	0.849	positive regulation of metabolic process
GO:0080090	0.833	regulation of primary metabolic process
GO:0031323	0.833	regulation of cellular metabolic process
GO:0051239	0.827	regulation of multicellular organismal process
GO:0003008	0.812	system process
GO:0007267	0.748	cell-cell signaling
GO:0010604	0.718	positive regulation of macromolecule metabolic process
GO:0010468	0.701	regulation of gene expression
GO:0048584	0.634	positive regulation of response to stimulus
GO:0048519	0.621	negative regulation of biological process
GO:0051171	0.547	regulation of nitrogen compound metabolic process
GO:0051179	0.535	localization
GO:0031325	0.432	positive regulation of cellular metabolic process
GO:0006810	0.409	transport
GO:0042221	0.388	response to chemical
GO:0008152	0.385	metabolic process
GO:0007186	0.343	G protein-coupled receptor signaling pathway
GO:0006950	0.336	response to stress
GO:0009892	0.319	negative regulation of metabolic process
GO:0010556	0.309	regulation of macromolecule biosynthetic process
GO:0031326	0.309	regulation of cellular biosynthetic process
GO:0009605	0.303	response to external stimulus
GO:0051173	0.301	positive regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.998	endomembrane system
GO:0031982	0.998	vesicle
GO:0005615	0.997	extracellular space
GO:0070013	0.996	intracellular organelle lumen
GO:0031410	0.994	cytoplasmic vesicle
GO:0099503	0.963	secretory vesicle
GO:0030141	0.946	secretory granule
GO:0016020	0.695	membrane
GO:0031983	0.578	vesicle lumen
GO:0060205	0.542	cytoplasmic vesicle lumen
GO:0034774	0.534	secretory granule lumen
GO:0005777	0.357	peroxisome
GO:0005782	0.335	peroxisomal matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]