StarFunc result for job id P01236

User Input

>input (227 residues)
MNIKGSPWKGSLLLLLVSNLLLCQSVAPLPICPGGAARCQVTLRDLFDRAVVLSHYIHNL
SSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWN
EPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSG
LPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P01236	1.000	1.000	2.512E-30	227	1.000	1.000	P01236.pdb.gz	PRL_HUMAN Prolactin OS=Homo sapiens OX=9606 GN=PRL PE=1 SV=1
2	AFDB:P01238	0.832	0.825	1.611E-22	229	0.736	0.729	P01238.pdb.gz	PRL_PIG Prolactin OS=Sus scrofa OX=9823 GN=PRL PE=1 SV=3
3	AFDB:W5PH94	0.881	0.866	4.957E-21	231	0.661	0.649	W5PH94.pdb.gz	W5PH94_SHEEP Prolactin OS=Ovis aries OX=9940 GN=PRL PE=3 SV=1
4	AFDB:E5RWR3	0.842	0.834	6.551E-20	229	0.604	0.598	E5RWR3.pdb.gz	E5RWR3_MELGA Prolactin OS=Meleagris gallopavo OX=9103 GN=PRL PE=3 SV=1
5	PDB:1rw5A	0.783	0.883	8.520E-20	199	0.877	1.000	1rw5A.pdb.gz
6	AFDB:P01237	0.781	0.785	2.784E-16	226	0.564	0.566	P01237.pdb.gz	PRL_RAT Prolactin OS=Rattus norvegicus OX=10116 GN=Prl PE=1 SV=1
7	PDB:3d48P	0.721	0.990	4.799E-16	165	0.722	0.994	3d48P.pdb.gz	Crystal structure of a prolactin receptor antagonist bound to the extracellular domain of the prolactin receptor
8	AFDB:P06879	0.795	0.798	1.999E-15	226	0.542	0.544	P06879.pdb.gz	PRL_MOUSE Prolactin OS=Mus musculus OX=10090 GN=Prl PE=2 SV=1
9	AFDB:W5PGF7	0.789	0.751	2.894E-13	239	0.388	0.368	W5PGF7.pdb.gz	W5PGF7_SHEEP Placental lactogen OS=Ovis aries OX=9940 GN=LOC443319 PE=3 SV=1
10	AFDB:P09586	0.772	0.788	7.756E-13	222	0.352	0.360	P09586.pdb.gz	PR3B1_MOUSE Prolactin-3B1 OS=Mus musculus OX=10090 GN=Prl3b1 PE=1 SV=1
11	AFDB:Q9JKL9	0.771	0.768	2.887E-12	228	0.344	0.342	Q9JKL9.pdb.gz	PR2B1_RAT Prolactin-2B1 OS=Rattus norvegicus OX=10116 GN=Prl2b1 PE=2 SV=2
12	AFDB:P09321	0.769	0.789	8.106E-12	221	0.344	0.353	P09321.pdb.gz	PR3B1_RAT Prolactin-3B1 OS=Rattus norvegicus OX=10116 GN=Prl3b1 PE=2 SV=2
13	PDB:1f6fA	0.739	0.910	7.933E-11	183	0.370	0.459	1f6fA.pdb.gz
14	PDB:1huwA	0.599	0.800	4.456E-6	166	0.185	0.253	1huwA.pdb.gz
15	PDB:1bp3A	0.628	0.755	5.635E-6	186	0.194	0.237	1bp3A.pdb.gz	The X-ray structure of a growth hormone-prolactin receptor complex.
16	PDB:1z7cA	0.549	0.742	9.417E-5	161	0.163	0.230	1z7cA.pdb.gz
17	PDB:7u7nD	0.572	0.670	8.937E-3	191	0.123	0.147	7u7nD.pdb.gz
18	PDB:7z0lB	0.439	0.286	2.510E-2	370	0.137	0.084	7z0lB.pdb.gz
19	PDB:6o4oA	0.503	0.650	2.757E-2	169	0.137	0.183	6o4oA.pdb.gz
20	PDB:4cniC	0.494	0.632	3.028E-2	171	0.115	0.152	4cniC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P01236	3.63e-171	471	227	1.000	1.000	PRL_HUMAN Prolactin OS=Homo sapiens OX=9606 GN=PRL PE=1 SV=1
2	P01238	2.53e-132	373	229	0.802	0.795	PRL_PIG Prolactin OS=Sus scrofa OX=9823 GN=PRL PE=1 SV=3
3	P01239	3.83e-115	330	229	0.731	0.725	PRL_BOVIN Prolactin OS=Bos taurus OX=9913 GN=PRL PE=1 SV=1
4	P01240	1.12e-114	328	229	0.731	0.725	PRL_SHEEP Prolactin OS=Ovis aries OX=9940 GN=PRL PE=1 SV=2
5	R9WQI9	1.12e-114	328	229	0.731	0.725	R9WQI9_SHEEP Prolactin OS=Ovis aries OX=9940 GN=PRL PE=3 SV=1
6	W5PH94	1.98e-113	325	231	0.656	0.645	W5PH94_SHEEP Prolactin OS=Ovis aries OX=9940 GN=PRL PE=3 SV=1
7	P14676	1.82e-111	320	229	0.683	0.677	PRL_CHICK Prolactin OS=Gallus gallus OX=9031 GN=PRL PE=2 SV=2
8	P17572	1.62e-106	308	229	0.630	0.624	PRL_MELGA Prolactin OS=Meleagris gallopavo OX=9103 GN=PRL PE=1 SV=2
9	E5RWR3	1.30e-105	306	229	0.626	0.620	E5RWR3_MELGA Prolactin OS=Meleagris gallopavo OX=9103 GN=PRL PE=3 SV=1
10	P01237	3.11e-92	271	226	0.564	0.566	PRL_RAT Prolactin OS=Rattus norvegicus OX=10116 GN=Prl PE=1 SV=1
11	P06879	9.30e-89	263	226	0.608	0.611	PRL_MOUSE Prolactin OS=Mus musculus OX=10090 GN=Prl PE=2 SV=1
12	O77687	3.48e-54	175	236	0.388	0.373	O77687_SHEEP Placental lactogen OS=Ovis aries OX=9940 GN=PL PE=3 SV=1
13	W5PGF6	5.13e-54	175	233	0.396	0.386	W5PGF6_SHEEP Placental lactogen OS=Ovis aries OX=9940 GN=LOC443319 PE=3 SV=1
14	P16038	1.06e-53	174	236	0.383	0.369	CSH_SHEEP Chorionic somatomammotropin hormone OS=Ovis aries OX=9940 GN=CSH PE=1 SV=1
15	W5PGF7	1.09e-53	174	239	0.383	0.364	W5PGF7_SHEEP Placental lactogen OS=Ovis aries OX=9940 GN=LOC443319 PE=3 SV=1
16	P09321	1.76e-52	170	221	0.388	0.398	PR3B1_RAT Prolactin-3B1 OS=Rattus norvegicus OX=10116 GN=Prl3b1 PE=2 SV=2
17	Q6LDQ9	3.46e-51	163	101	0.335	0.752	Q6LDQ9_BOVIN Prolactin (Fragment) OS=Bos taurus OX=9913 PE=2 SV=1
18	P09586	1.64e-50	166	222	0.326	0.333	PR3B1_MOUSE Prolactin-3B1 OS=Mus musculus OX=10090 GN=Prl3b1 PE=1 SV=1
19	P04769	2.11e-49	163	244	0.405	0.377	PR7D1_MOUSE Prolactin-7D1 OS=Mus musculus OX=10090 GN=Prl7d1 PE=2 SV=1
20	Q6VLX2	6.55e-46	149	99	0.304	0.697	Q6VLX2_BOVIN Prolactin (Fragment) OS=Bos taurus OX=9913 GN=prolactin PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00103 Hormone_1	1.4e-75	265.3	Somatotropin hormone family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000302150

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000482954	0.999	Prolactin receptor
2	9606.ENSP00000371067	0.986	Tyrosine-protein kinase JAK2
3	9606.ENSP00000341208	0.979	Signal transducer and activator of transcription 5A
4	9606.ENSP00000333157	0.967	Growth hormone 1 isoform 5
5	9606.ENSP00000312652	0.946	Leptin
6	9606.ENSP00000293328	0.932	Signal transducer and activator of transcription 5B
7	9606.ENSP00000342235	0.930	Receptor tyrosine-protein kinase erbB-4
8	9606.ENSP00000230990	0.929	Proheparin-binding EGF-like growth factor
9	9606.ENSP00000384092	0.925	Pro-opiomelanocortin
10	9606.ENSP00000380432	0.921	Insulin
11	9606.ENSP00000303452	0.910	Pro-thyrotropin-releasing hormone
12	9606.ENSP00000376623	0.907	Chorionic somatomammotropin hormone 2
13	9606.ENSP00000316416	0.905	Chorionic somatomammotropin hormone 1
14	9606.ENSP00000252723	0.901	Erythropoietin
15	9606.ENSP00000312673	0.899	Somatotropin
16	9606.ENSP00000204615	0.898	Thrombopoietin
17	9606.ENSP00000256592	0.871	Thyrotropin subunit beta
18	9606.ENSP00000342931	0.868	Pituitary-specific positive transcription factor 1
19	9606.ENSP00000483403	0.867	Growth hormone receptor
20	9606.ENSP00000225474	0.866	Granulocyte colony-stimulating factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005126	1.000	cytokine receptor binding
GO:0140677	0.939	molecular function activator activity
GO:0048018	0.918	receptor ligand activity
GO:0005148	0.702	prolactin receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0019222	0.990	regulation of metabolic process
GO:0048518	0.989	positive regulation of biological process
GO:0009987	0.988	cellular process
GO:0050896	0.987	response to stimulus
GO:0048522	0.977	positive regulation of cellular process
GO:0023052	0.971	signaling
GO:0007154	0.968	cell communication
GO:0065008	0.965	regulation of biological quality
GO:0031323	0.961	regulation of cellular metabolic process
GO:0009893	0.958	positive regulation of metabolic process
GO:0048519	0.956	negative regulation of biological process
GO:0080090	0.922	regulation of primary metabolic process
GO:0048523	0.918	negative regulation of cellular process
GO:0060255	0.913	regulation of macromolecule metabolic process
GO:0023051	0.891	regulation of signaling
GO:0010646	0.891	regulation of cell communication
GO:0009889	0.889	regulation of biosynthetic process
GO:0010468	0.883	regulation of gene expression
GO:0010604	0.881	positive regulation of macromolecule metabolic process
GO:0031325	0.876	positive regulation of cellular metabolic process
GO:0007165	0.861	signal transduction
GO:0051239	0.857	regulation of multicellular organismal process
GO:0007267	0.847	cell-cell signaling
GO:0008152	0.846	metabolic process
GO:0031326	0.841	regulation of cellular biosynthetic process
GO:0042127	0.800	regulation of cell population proliferation
GO:0010628	0.785	positive regulation of gene expression
GO:0042981	0.784	regulation of apoptotic process
GO:0009891	0.775	positive regulation of biosynthetic process
GO:0051171	0.754	regulation of nitrogen compound metabolic process
GO:0008284	0.745	positive regulation of cell population proliferation
GO:0019216	0.736	regulation of lipid metabolic process
GO:0048583	0.729	regulation of response to stimulus
GO:0051241	0.724	negative regulation of multicellular organismal process
GO:0023061	0.718	signal release
GO:0009892	0.714	negative regulation of metabolic process
GO:0062013	0.714	positive regulation of small molecule metabolic process
GO:0030072	0.713	peptide hormone secretion
GO:0031328	0.709	positive regulation of cellular biosynthetic process
GO:0023057	0.708	negative regulation of signaling
GO:0010648	0.708	negative regulation of cell communication
GO:0009966	0.697	regulation of signal transduction
GO:0045834	0.691	positive regulation of lipid metabolic process
GO:0023056	0.690	positive regulation of signaling
GO:0010647	0.690	positive regulation of cell communication
GO:0019217	0.673	regulation of fatty acid metabolic process
GO:0046889	0.671	positive regulation of lipid biosynthetic process
GO:0042304	0.598	regulation of fatty acid biosynthetic process
GO:0051173	0.595	positive regulation of nitrogen compound metabolic process
GO:0050678	0.558	regulation of epithelial cell proliferation
GO:0071704	0.528	organic substance metabolic process
GO:0051252	0.486	regulation of RNA metabolic process
GO:0010556	0.485	regulation of macromolecule biosynthetic process
GO:0006355	0.484	regulation of DNA-templated transcription
GO:0048584	0.483	positive regulation of response to stimulus
GO:0032501	0.479	multicellular organismal process
GO:0042221	0.478	response to chemical
GO:0048856	0.469	anatomical structure development
GO:0001936	0.463	regulation of endothelial cell proliferation
GO:0060548	0.433	negative regulation of cell death
GO:0007166	0.423	cell surface receptor signaling pathway
GO:0010033	0.414	response to organic substance
GO:0009967	0.404	positive regulation of signal transduction
GO:0043069	0.384	negative regulation of programmed cell death
GO:0070887	0.374	cellular response to chemical stimulus
GO:0009628	0.367	response to abiotic stimulus
GO:0045935	0.367	positive regulation of nucleobase-containing compound metabolic process
GO:0044238	0.336	primary metabolic process
GO:0051254	0.331	positive regulation of RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.997	extracellular space
GO:0005622	0.818	intracellular anatomical structure
GO:0043226	0.806	organelle
GO:0012505	0.789	endomembrane system
GO:0043227	0.725	membrane-bounded organelle
GO:0043231	0.607	intracellular membrane-bounded organelle
GO:0005737	0.519	cytoplasm
GO:0070013	0.429	intracellular organelle lumen
GO:0016020	0.338	membrane
GO:0031982	0.326	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]