StarFunc result for job id P01241

User Input

>input (217 residues)
MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEA
YIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLR
SVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDD
ALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P01241	1.000	1.000	8.498E-29	217	1.000	1.000	P01241.pdb.gz	SOMA_HUMAN Somatotropin OS=Homo sapiens OX=9606 GN=GH1 PE=1 SV=2
2	AFDB:P0DML2	0.896	0.896	3.951E-22	217	0.853	0.853	P0DML2.pdb.gz	CSH1_HUMAN Chorionic somatomammotropin hormone 1 OS=Homo sapiens OX=9606 GN=CSH1 PE=1 SV=1
3	AFDB:A0FJ27	0.800	0.800	1.735E-17	217	0.664	0.664	A0FJ27.pdb.gz	A0FJ27_SHEEP Growth hormone OS=Ovis aries OX=9940 PE=2 SV=1
4	PDB:1bp3A	0.751	0.867	2.608E-17	186	0.853	0.995	1bp3A.pdb.gz	The X-ray structure of a growth hormone-prolactin receptor complex.
5	AFDB:P01244	0.839	0.842	8.210E-17	216	0.650	0.653	P01244.pdb.gz	SOMA_RAT Somatotropin OS=Rattus norvegicus OX=10116 GN=Gh1 PE=1 SV=1
6	AFDB:H6ULW9	0.808	0.812	2.807E-15	216	0.493	0.495	H6ULW9.pdb.gz	H6ULW9_CHICK Growth hormone OS=Gallus gallus OX=9031 GN=GH PE=3 SV=1
7	PDB:1z7cA	0.656	0.875	2.092E-14	161	0.636	0.857	1z7cA.pdb.gz
8	PDB:1huwA	0.680	0.871	2.775E-14	166	0.691	0.904	1huwA.pdb.gz
9	AFDB:Q1JQ34	0.715	0.737	2.285E-9	210	0.355	0.367	Q1JQ34.pdb.gz	Q1JQ34_DANRE Growth hormone 1 OS=Danio rerio OX=7955 GN=ghl PE=2 SV=1
10	AFDB:B2Z9Z2	0.682	0.703	3.509E-8	210	0.332	0.343	B2Z9Z2.pdb.gz	B2Z9Z2_SALSA Growth hormone 2 OS=Salmo salar OX=8030 GN=LOC106607462 PE=3 SV=1
11	AFDB:A7LFX3	0.672	0.724	6.784E-8	200	0.309	0.335	A7LFX3.pdb.gz	A7LFX3_ICTPU Growth hormone OS=Ictalurus punctatus OX=7998 GN=gh1 PE=2 SV=1
12	AFDB:P18121	0.681	0.662	1.086E-7	224	0.253	0.246	P18121.pdb.gz	PR3D1_MOUSE Prolactin-3D1 OS=Mus musculus OX=10090 GN=Prl3d1 PE=2 SV=1
13	AFDB:A3FEU9	0.679	0.717	1.139E-7	204	0.290	0.309	A3FEU9.pdb.gz	A3FEU9_9CICH Somatotropin OS=Oreochromis urolepis hornorum OX=161276 PE=2 SV=1
14	PDB:1f6fA	0.644	0.753	3.830E-6	183	0.221	0.262	1f6fA.pdb.gz
15	PDB:1rw5A	0.673	0.728	1.079E-5	199	0.217	0.236	1rw5A.pdb.gz
16	PDB:3d48P	0.627	0.805	1.243E-5	165	0.184	0.242	3d48P.pdb.gz	Crystal structure of a prolactin receptor antagonist bound to the extracellular domain of the prolactin receptor
17	PDB:7u7nD	0.471	0.529	4.293E-2	191	0.157	0.178	7u7nD.pdb.gz
18	PDB:7zxkC	0.497	0.633	1.050E-1	166	0.134	0.175	7zxkC.pdb.gz
19	PDB:3pivB	0.378	0.482	2.339E-1	157	0.078	0.108	3pivB.pdb.gz
20	PDB:6o4oA	0.503	0.616	2.452E-1	169	0.138	0.178	6o4oA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P01241	2.73e-162	448	217	1.000	1.000	SOMA_HUMAN Somatotropin OS=Homo sapiens OX=9606 GN=GH1 PE=1 SV=2
2	P01242	4.27e-131	369	217	0.931	0.931	SOM2_HUMAN Growth hormone variant OS=Homo sapiens OX=9606 GN=GH2 PE=1 SV=3
3	P0DML3	4.74e-120	341	217	0.853	0.853	CSH2_HUMAN Chorionic somatomammotropin hormone 2 OS=Homo sapiens OX=9606 GN=CSH2 PE=1 SV=1
4	P0DML2	1.42e-119	340	217	0.853	0.853	CSH1_HUMAN Chorionic somatomammotropin hormone 1 OS=Homo sapiens OX=9606 GN=CSH1 PE=1 SV=1
5	P01248	2.56e-97	284	216	0.682	0.685	SOMA_PIG Somatotropin OS=Sus scrofa OX=9823 GN=GH1 PE=1 SV=2
6	P06880	5.05e-97	283	216	0.668	0.671	SOMA_MOUSE Somatotropin OS=Mus musculus OX=10090 GN=Gh1 PE=2 SV=1
7	P01244	3.10e-93	273	216	0.650	0.653	SOMA_RAT Somatotropin OS=Rattus norvegicus OX=10116 GN=Gh1 PE=1 SV=1
8	G3CI04	1.10e-91	270	217	0.664	0.664	G3CI04_SHEEP Growth hormone OS=Ovis aries OX=9940 PE=2 SV=1
9	Q0QBC4	2.89e-90	266	217	0.664	0.664	Q0QBC4_SHEEP Growth hormone OS=Ovis aries OX=9940 GN=GH PE=3 SV=1
10	B0FPG6	4.74e-85	253	217	0.673	0.673	B0FPG6_BOVIN Growth hormone OS=Bos taurus OX=9913 GN=GH PE=2 SV=1
11	P01246	4.74e-85	253	217	0.673	0.673	SOMA_BOVIN Somatotropin OS=Bos taurus OX=9913 GN=GH1 PE=1 SV=1
12	Q95205	8.67e-85	251	204	0.622	0.662	Q95205_SHEEP Placental growth hormone (Fragment) OS=Ovis aries OX=9940 PE=2 SV=1
13	B0FPG4	1.08e-84	252	217	0.668	0.668	B0FPG4_BOVIN Growth hormone OS=Bos taurus OX=9913 GN=GH1 PE=3 SV=1
14	Q0QBF7	8.59e-84	249	217	0.668	0.668	Q0QBF7_SHEEP Growth hormone OS=Ovis aries OX=9940 GN=GH PE=3 SV=1
15	A4GX95	1.17e-83	249	217	0.668	0.668	A4GX95_BOVIN Growth hormone OS=Bos taurus OX=9913 PE=2 SV=1
16	P67930	1.17e-83	249	217	0.668	0.668	SOMA_SHEEP Somatotropin OS=Ovis aries OX=9940 GN=GH1 PE=1 SV=1
17	Q71VP3	1.17e-83	249	217	0.668	0.668	Q71VP3_SHEEP Growth hormone OS=Ovis aries OX=9940 GN=GH PE=2 SV=1
18	Q0QBC6	1.32e-83	249	217	0.668	0.668	Q0QBC6_SHEEP Growth hormone OS=Ovis aries OX=9940 GN=GH PE=3 SV=1
19	Q0QBG3	1.37e-83	249	217	0.668	0.668	Q0QBG3_SHEEP Growth hormone OS=Ovis aries OX=9940 GN=GH PE=3 SV=1
20	Q0QBF8	2.77e-83	248	217	0.668	0.668	Q0QBF8_SHEEP Growth hormone OS=Ovis aries OX=9940 GN=GH PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00103 Hormone_1	1.6e-58	209.6	Somatotropin hormone family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000312673

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000483403	0.999	Growth hormone receptor
2	9606.ENSP00000482954	0.984	Prolactin receptor
3	9606.ENSP00000335074	0.970	Appetite-regulating hormone
4	9606.ENSP00000293328	0.936	Signal transducer and activator of transcription 5B
5	9606.ENSP00000371067	0.933	Tyrosine-protein kinase JAK2
6	9606.ENSP00000341208	0.930	Signal transducer and activator of transcription 5A
7	9606.ENSP00000409346	0.925	Cytokine-inducible SH2-containing protein
8	9606.ENSP00000312652	0.924	Leptin
9	9606.ENSP00000304895	0.923	Insulin receptor substrate 1
10	9606.ENSP00000365016	0.914	Insulin receptor substrate 2
11	9606.ENSP00000263025	0.912	Mitogen-activated protein kinase 3
12	9606.ENSP00000215832	0.900	Mitogen-activated protein kinase 1
13	9606.ENSP00000244007	0.900	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
14	9606.ENSP00000263967	0.900	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
15	9606.ENSP00000291526	0.900	Trefoil factor 2
16	9606.ENSP00000291527	0.900	Trefoil factor 1
17	9606.ENSP00000391592	0.900	Tyrosine-protein phosphatase non-receptor type 6
18	9606.ENSP00000428056	0.900	Phosphatidylinositol 3-kinase regulatory subunit alpha
19	9606.ENSP00000430690	0.900	Trefoil factor 3
20	9606.ENSP00000302150	0.899	Prolactin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0048018	0.975	receptor ligand activity
GO:0005126	0.970	cytokine receptor binding
GO:0005131	0.848	growth hormone receptor binding
GO:0003824	0.331	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0048518	0.995	positive regulation of biological process
GO:0048522	0.994	positive regulation of cellular process
GO:0019222	0.992	regulation of metabolic process
GO:0050896	0.991	response to stimulus
GO:0009987	0.971	cellular process
GO:0009893	0.970	positive regulation of metabolic process
GO:0031323	0.967	regulation of cellular metabolic process
GO:0060255	0.961	regulation of macromolecule metabolic process
GO:0051716	0.941	cellular response to stimulus
GO:0031325	0.934	positive regulation of cellular metabolic process
GO:0050730	0.929	regulation of peptidyl-tyrosine phosphorylation
GO:0031401	0.925	positive regulation of protein modification process
GO:0050731	0.924	positive regulation of peptidyl-tyrosine phosphorylation
GO:0023052	0.878	signaling
GO:0007154	0.878	cell communication
GO:0032879	0.878	regulation of localization
GO:0051050	0.865	positive regulation of transport
GO:0023051	0.847	regulation of signaling
GO:0007165	0.844	signal transduction
GO:0044093	0.843	positive regulation of molecular function
GO:0010646	0.819	regulation of cell communication
GO:0042127	0.806	regulation of cell population proliferation
GO:0034762	0.801	regulation of transmembrane transport
GO:0042221	0.774	response to chemical
GO:0007166	0.752	cell surface receptor signaling pathway
GO:0048583	0.741	regulation of response to stimulus
GO:0034764	0.741	positive regulation of transmembrane transport
GO:0010033	0.738	response to organic substance
GO:1902531	0.710	regulation of intracellular signal transduction
GO:0010647	0.708	positive regulation of cell communication
GO:0023056	0.705	positive regulation of signaling
GO:0009719	0.694	response to endogenous stimulus
GO:0009967	0.683	positive regulation of signal transduction
GO:0070887	0.657	cellular response to chemical stimulus
GO:0014066	0.589	regulation of phosphatidylinositol 3-kinase signaling
GO:0048519	0.581	negative regulation of biological process
GO:0071495	0.577	cellular response to endogenous stimulus
GO:0071310	0.575	cellular response to organic substance
GO:0032501	0.560	multicellular organismal process
GO:0042509	0.559	regulation of tyrosine phosphorylation of STAT protein
GO:0009725	0.551	response to hormone
GO:1901700	0.510	response to oxygen-containing compound
GO:0042531	0.493	positive regulation of tyrosine phosphorylation of STAT protein
GO:0051239	0.490	regulation of multicellular organismal process
GO:0008284	0.487	positive regulation of cell population proliferation
GO:0006950	0.467	response to stress
GO:0032502	0.462	developmental process
GO:0007167	0.459	enzyme-linked receptor protein signaling pathway
GO:0010243	0.450	response to organonitrogen compound
GO:0048523	0.438	negative regulation of cellular process
GO:1902533	0.423	positive regulation of intracellular signal transduction
GO:0048856	0.421	anatomical structure development
GO:1901652	0.417	response to peptide
GO:0051240	0.412	positive regulation of multicellular organismal process
GO:0007169	0.410	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0043434	0.400	response to peptide hormone
GO:0010468	0.391	regulation of gene expression
GO:0032870	0.361	cellular response to hormone stimulus
GO:1904892	0.332	regulation of receptor signaling pathway via STAT
GO:0043408	0.331	regulation of MAPK cascade
GO:1904894	0.303	positive regulation of receptor signaling pathway via STAT

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0005737	0.995	cytoplasm
GO:0012505	0.990	endomembrane system
GO:0031982	0.977	vesicle
GO:0031974	0.975	membrane-enclosed lumen
GO:0070013	0.972	intracellular organelle lumen
GO:0031410	0.961	cytoplasmic vesicle
GO:0005615	0.938	extracellular space
GO:0005768	0.914	endosome
GO:0031904	0.819	endosome lumen
GO:0016020	0.816	membrane
GO:0071944	0.728	cell periphery
GO:0005886	0.700	plasma membrane
GO:0032991	0.455	protein-containing complex
GO:0031981	0.450	nuclear lumen
GO:0005654	0.324	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]