StarFunc result for job id P01242

User Input

>input (217 residues)
MAAGSRTSLLLAFGLLCLSWLQEGSAFPTIPLSRLFDNAMLRARRLYQLAYDTYQEFEEA
YILKEQKYSFLQNPQTSLCFSESIPTPSNRVKTQQKSNLELLRISLLLIQSWLEPVQLLR
SVFANSLVYGASDSNVYRHLKDLEEGIQTLMWRLEDGSPRTGQIFNQSYSKFDTKSHNDD
ALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P01241	0.855	0.855	8.940E-22	217	0.931	0.931	P01241.pdb.gz	SOMA_HUMAN Somatotropin OS=Homo sapiens OX=9606 GN=GH1 PE=1 SV=2
2	AFDB:P0DML2	0.769	0.769	8.143E-18	217	0.797	0.797	P0DML2.pdb.gz	CSH1_HUMAN Chorionic somatomammotropin hormone 1 OS=Homo sapiens OX=9606 GN=CSH1 PE=1 SV=1
3	PDB:1bp3A	0.785	0.910	4.289E-17	186	0.793	0.925	1bp3A.pdb.gz	The X-ray structure of a growth hormone-prolactin receptor complex.
4	PDB:1huwA	0.718	0.928	1.413E-14	166	0.659	0.861	1huwA.pdb.gz
5	AFDB:A0FJ27	0.731	0.731	3.197E-14	217	0.631	0.631	A0FJ27.pdb.gz	A0FJ27_SHEEP Growth hormone OS=Ovis aries OX=9940 PE=2 SV=1
6	AFDB:P01244	0.766	0.769	3.350E-14	216	0.618	0.620	P01244.pdb.gz	SOMA_RAT Somatotropin OS=Rattus norvegicus OX=10116 GN=Gh1 PE=1 SV=1
7	AFDB:H6ULW9	0.735	0.739	7.331E-13	216	0.479	0.481	H6ULW9.pdb.gz	H6ULW9_CHICK Growth hormone OS=Gallus gallus OX=9031 GN=GH PE=3 SV=1
8	PDB:1z7cA	0.591	0.777	1.984E-11	161	0.594	0.801	1z7cA.pdb.gz
9	AFDB:A7LFX3	0.699	0.754	6.373E-9	200	0.309	0.335	A7LFX3.pdb.gz	A7LFX3_ICTPU Growth hormone OS=Ictalurus punctatus OX=7998 GN=gh1 PE=2 SV=1
10	AFDB:Q1JQ34	0.725	0.747	6.678E-9	210	0.355	0.367	Q1JQ34.pdb.gz	Q1JQ34_DANRE Growth hormone 1 OS=Danio rerio OX=7955 GN=ghl PE=2 SV=1
11	AFDB:B2Z9Z2	0.710	0.732	5.474E-8	210	0.332	0.343	B2Z9Z2.pdb.gz	B2Z9Z2_SALSA Growth hormone 2 OS=Salmo salar OX=8030 GN=LOC106607462 PE=3 SV=1
12	AFDB:A3FEU9	0.676	0.716	2.812E-7	204	0.272	0.289	A3FEU9.pdb.gz	A3FEU9_9CICH Somatotropin OS=Oreochromis urolepis hornorum OX=161276 PE=2 SV=1
13	AFDB:P01238	0.600	0.572	4.087E-7	229	0.249	0.236	P01238.pdb.gz	PRL_PIG Prolactin OS=Sus scrofa OX=9823 GN=PRL PE=1 SV=3
14	PDB:1f6fA	0.632	0.741	1.850E-5	183	0.217	0.257	1f6fA.pdb.gz
15	PDB:1rw5A	0.639	0.692	1.938E-5	199	0.203	0.221	1rw5A.pdb.gz
16	PDB:3d48P	0.539	0.676	3.057E-4	165	0.184	0.242	3d48P.pdb.gz	Crystal structure of a prolactin receptor antagonist bound to the extracellular domain of the prolactin receptor
17	PDB:7u7nD	0.472	0.528	4.767E-2	191	0.147	0.168	7u7nD.pdb.gz
18	PDB:1rhgB	0.380	0.514	8.755E-2	144	0.092	0.139	1rhgB.pdb.gz
19	PDB:7zxkC	0.406	0.509	1.938E-1	166	0.143	0.187	7zxkC.pdb.gz
20	PDB:6o4oA	0.436	0.531	2.031E-1	169	0.147	0.189	6o4oA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P01242	6.02e-162	447	217	1.000	1.000	SOM2_HUMAN Growth hormone variant OS=Homo sapiens OX=9606 GN=GH2 PE=1 SV=3
2	P01241	1.94e-131	370	217	0.931	0.931	SOMA_HUMAN Somatotropin OS=Homo sapiens OX=9606 GN=GH1 PE=1 SV=2
3	P0DML3	8.60e-109	313	217	0.802	0.802	CSH2_HUMAN Chorionic somatomammotropin hormone 2 OS=Homo sapiens OX=9606 GN=CSH2 PE=1 SV=1
4	P0DML2	1.08e-107	310	217	0.797	0.797	CSH1_HUMAN Chorionic somatomammotropin hormone 1 OS=Homo sapiens OX=9606 GN=CSH1 PE=1 SV=1
5	P01248	5.95e-90	265	216	0.650	0.653	SOMA_PIG Somatotropin OS=Sus scrofa OX=9823 GN=GH1 PE=1 SV=2
6	P06880	4.60e-89	263	216	0.627	0.630	SOMA_MOUSE Somatotropin OS=Mus musculus OX=10090 GN=Gh1 PE=2 SV=1
7	P01244	8.20e-87	257	216	0.618	0.620	SOMA_RAT Somatotropin OS=Rattus norvegicus OX=10116 GN=Gh1 PE=1 SV=1
8	G3CI04	1.24e-84	251	217	0.631	0.631	G3CI04_SHEEP Growth hormone OS=Ovis aries OX=9940 PE=2 SV=1
9	Q0QBC4	3.56e-83	248	217	0.631	0.631	Q0QBC4_SHEEP Growth hormone OS=Ovis aries OX=9940 GN=GH PE=3 SV=1
10	Q95205	3.37e-78	235	204	0.590	0.627	Q95205_SHEEP Placental growth hormone (Fragment) OS=Ovis aries OX=9940 PE=2 SV=1
11	B0FPG6	3.77e-78	235	217	0.641	0.641	B0FPG6_BOVIN Growth hormone OS=Bos taurus OX=9913 GN=GH PE=2 SV=1
12	P01246	3.77e-78	235	217	0.641	0.641	SOMA_BOVIN Somatotropin OS=Bos taurus OX=9913 GN=GH1 PE=1 SV=1
13	Q0QBF7	3.77e-78	235	217	0.641	0.641	Q0QBF7_SHEEP Growth hormone OS=Ovis aries OX=9940 GN=GH PE=3 SV=1
14	Q0QBG3	6.03e-78	234	217	0.641	0.641	Q0QBG3_SHEEP Growth hormone OS=Ovis aries OX=9940 GN=GH PE=3 SV=1
15	B0FPG4	8.01e-78	234	217	0.636	0.636	B0FPG4_BOVIN Growth hormone OS=Bos taurus OX=9913 GN=GH1 PE=3 SV=1
16	Q0QBF8	1.06e-77	234	217	0.641	0.641	Q0QBF8_SHEEP Growth hormone OS=Ovis aries OX=9940 GN=GH PE=3 SV=1
17	Q0QBG2	1.88e-77	233	217	0.636	0.636	Q0QBG2_SHEEP Growth hormone OS=Ovis aries OX=9940 GN=GH PE=3 SV=1
18	Q0QBH2	2.81e-77	233	217	0.636	0.636	Q0QBH2_SHEEP Growth hormone OS=Ovis aries OX=9940 GN=GH PE=3 SV=1
19	Q0QBH1	7.52e-77	232	217	0.636	0.636	Q0QBH1_SHEEP Growth hormone OS=Ovis aries OX=9940 GN=GH PE=3 SV=1
20	A4GX95	9.56e-77	231	217	0.636	0.636	A4GX95_BOVIN Growth hormone OS=Bos taurus OX=9913 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04578 DUF594	3.1e+02	12.4	Protein of unknown function, DUF594
2	PF00103 Hormone_1	2.4e-58	208.9	Somatotropin hormone family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000056409

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000028855	0.978	Uncharacterized protein
2	9598.ENSPTRP00000030340	0.910	Uncharacterized protein
3	9598.ENSPTRP00000028787	0.897	This is a receptor for the anterior pituitary hormone prolactin
4	9598.ENSPTRP00000033657	0.837	Leptin
5	9598.ENSPTRP00000035490	0.817	Tyrosine-protein kinase
6	9598.ENSPTRP00000033390	0.803	Erythropoietin
7	9598.ENSPTRP00000006354	0.800	Ciliary neurotrophic factor
8	9598.ENSPTRP00000040014	0.800	Uncharacterized protein
9	9598.ENSPTRP00000054251	0.800	Pan troglodytes placental lactogen PL-D (PL-D), mRNA
10	9598.ENSPTRP00000001425	0.752	Tyrosine-protein kinase
11	9598.ENSPTRP00000016060	0.648	Uncharacterized protein
12	9598.ENSPTRP00000030075	0.646	CDC-like kinase 4
13	9598.ENSPTRP00000041717	0.638	CLK4-associating serine/arginine rich protein
14	9598.ENSPTRP00000032807	0.626	Receptor protein-tyrosine kinase
15	9598.ENSPTRP00000059210	0.617	Uncharacterized protein
16	9598.ENSPTRP00000003828	0.615	Uncharacterized protein
17	9598.ENSPTRP00000000960	0.610	Uncharacterized protein
18	9598.ENSPTRP00000040421	0.610	Interleukin 6 signal transducer (Gp130, oncostatin M receptor)
19	9598.ENSPTRP00000052139	0.605	Uncharacterized protein
20	9598.ENSPTRP00000018055	0.601	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0005126	0.976	cytokine receptor binding
GO:0048018	0.968	receptor ligand activity
GO:0005131	0.849	growth hormone receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048522	0.996	positive regulation of cellular process
GO:0050896	0.992	response to stimulus
GO:0019222	0.973	regulation of metabolic process
GO:0009987	0.963	cellular process
GO:0009893	0.946	positive regulation of metabolic process
GO:0031323	0.938	regulation of cellular metabolic process
GO:0060255	0.931	regulation of macromolecule metabolic process
GO:0031325	0.913	positive regulation of cellular metabolic process
GO:0080090	0.882	regulation of primary metabolic process
GO:0007154	0.876	cell communication
GO:0023052	0.875	signaling
GO:0051050	0.867	positive regulation of transport
GO:0051171	0.853	regulation of nitrogen compound metabolic process
GO:0007165	0.846	signal transduction
GO:0044093	0.840	positive regulation of molecular function
GO:0031399	0.835	regulation of protein modification process
GO:0051174	0.803	regulation of phosphorus metabolic process
GO:0042325	0.789	regulation of phosphorylation
GO:0034762	0.784	regulation of transmembrane transport
GO:0042327	0.781	positive regulation of phosphorylation
GO:0009628	0.774	response to abiotic stimulus
GO:0001934	0.759	positive regulation of protein phosphorylation
GO:0034764	0.732	positive regulation of transmembrane transport
GO:0048583	0.729	regulation of response to stimulus
GO:0023051	0.720	regulation of signaling
GO:0010646	0.720	regulation of cell communication
GO:0042221	0.714	response to chemical
GO:0023056	0.702	positive regulation of signaling
GO:0010647	0.702	positive regulation of cell communication
GO:0009966	0.681	regulation of signal transduction
GO:0009967	0.672	positive regulation of signal transduction
GO:0050730	0.658	regulation of peptidyl-tyrosine phosphorylation
GO:0010033	0.656	response to organic substance
GO:0007166	0.602	cell surface receptor signaling pathway
GO:0009719	0.568	response to endogenous stimulus
GO:0050731	0.552	positive regulation of peptidyl-tyrosine phosphorylation
GO:0070887	0.534	cellular response to chemical stimulus
GO:0042127	0.518	regulation of cell population proliferation
GO:0071310	0.514	cellular response to organic substance
GO:1901700	0.469	response to oxygen-containing compound
GO:0051239	0.469	regulation of multicellular organismal process
GO:0032501	0.452	multicellular organismal process
GO:0048519	0.451	negative regulation of biological process
GO:0006950	0.442	response to stress
GO:0032502	0.412	developmental process
GO:0048523	0.411	negative regulation of cellular process
GO:0071495	0.377	cellular response to endogenous stimulus
GO:0010959	0.368	regulation of metal ion transport
GO:0007169	0.368	transmembrane receptor protein tyrosine kinase signaling pathway
GO:1904062	0.357	regulation of monoatomic cation transmembrane transport
GO:0048856	0.356	anatomical structure development
GO:0051240	0.351	positive regulation of multicellular organismal process
GO:0009725	0.346	response to hormone
GO:0010468	0.321	regulation of gene expression
GO:0008284	0.321	positive regulation of cell population proliferation
GO:1902531	0.308	regulation of intracellular signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.998	extracellular region
GO:0005622	0.995	intracellular anatomical structure
GO:0043226	0.993	organelle
GO:0005737	0.993	cytoplasm
GO:0012505	0.988	endomembrane system
GO:0043231	0.981	intracellular membrane-bounded organelle
GO:0031982	0.973	vesicle
GO:0070013	0.972	intracellular organelle lumen
GO:0097708	0.957	intracellular vesicle
GO:0031410	0.953	cytoplasmic vesicle
GO:0005615	0.887	extracellular space
GO:0005768	0.875	endosome
GO:0016020	0.733	membrane
GO:0071944	0.459	cell periphery
GO:0031981	0.383	nuclear lumen
GO:0031904	0.376	endosome lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]