StarFunc result for job id P01258

User Input

>input (141 residues)
MGFQKFSPFLALSILVLLQAGSLHAAPFRSALESSPADPATLSEDEARLLLAALVQDYVQ
MKASELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKR
DMSSDLERDHRPHVSMPQNAN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P01258	1.000	1.000	1.690E-19	141	1.000	1.000	P01258.pdb.gz	CALC_HUMAN Calcitonin OS=Homo sapiens OX=9606 GN=CALCA PE=1 SV=3
2	AFDB:P01257	0.361	0.370	3.678E-12	136	0.738	0.765	P01257.pdb.gz	CALC_RAT Calcitonin OS=Rattus norvegicus OX=10116 GN=Calca PE=1 SV=1
3	AFDB:P06881	0.376	0.409	2.798E-8	128	0.617	0.680	P06881.pdb.gz	CALCA_HUMAN Calcitonin gene-related peptide 1 OS=Homo sapiens OX=9606 GN=CALCA PE=1 SV=4
4	AFDB:P10092	0.324	0.356	1.843E-7	127	0.567	0.630	P10092.pdb.gz	CALCB_HUMAN Calcitonin gene-related peptide 2 OS=Homo sapiens OX=9606 GN=CALCB PE=1 SV=1
5	AFDB:P01256	0.350	0.380	3.710E-6	128	0.475	0.523	P01256.pdb.gz	CALCA_RAT Calcitonin gene-related peptide 1 OS=Rattus norvegicus OX=10116 GN=Calca PE=2 SV=1
6	AFDB:F1QIK6	0.334	0.350	7.467E-5	133	0.433	0.459	F1QIK6.pdb.gz	F1QIK6_DANRE Calcitonin gene-related peptide 2 isoform X1 OS=Danio rerio OX=7955 GN=calc PE=3 SV=1
7	AFDB:Q61792	0.192	0.119	5.680E-1	263	0.149	0.080	Q61792.pdb.gz	LASP1_MOUSE LIM and SH3 domain protein 1 OS=Mus musculus OX=10090 GN=Lasp1 PE=1 SV=1
8	AFDB:Q9VG55	0.207	0.165	1.224	191	0.177	0.131	Q9VG55.pdb.gz	HUGIN_DROME Protein hugin OS=Drosophila melanogaster OX=7227 GN=Hug PE=1 SV=1
9	AFDB:A8MZ97	0.245	0.181	1.313	194	0.113	0.082	A8MZ97.pdb.gz	CB074_HUMAN Uncharacterized protein C2orf74 OS=Homo sapiens OX=9606 GN=C2orf74 PE=1 SV=4
10	AFDB:E9PQ02	0.168	0.137	1.313	189	0.156	0.116	E9PQ02.pdb.gz	E9PQ02_HUMAN Kinesin light chain (Fragment) OS=Homo sapiens OX=9606 GN=KLC2 PE=1 SV=1
11	PDB:7ajuUC	0.172	0.256	4.500	86	0.071	0.116	7ajuUC.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
12	PDB:7d4i5H	0.172	0.242	6.842	95	0.085	0.126	7d4i5H.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
13	PDB:6v8oO	0.158	0.068	7.336	384	0.092	0.034	6v8oO.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.
14	PDB:7b93p	0.227	0.195	9.046	171	0.113	0.094	7b93p.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P01258	1.55e-102	291	141	1.000	1.000	CALC_HUMAN Calcitonin OS=Homo sapiens OX=9606 GN=CALCA PE=1 SV=3
2	P01257	2.46e-61	186	136	0.723	0.750	CALC_RAT Calcitonin OS=Rattus norvegicus OX=10116 GN=Calca PE=1 SV=1
3	P70160	1.71e-60	184	136	0.723	0.750	CALC_MOUSE Calcitonin OS=Mus musculus OX=10090 GN=Calca PE=2 SV=1
4	P06881	1.96e-48	154	128	0.603	0.664	CALCA_HUMAN Calcitonin gene-related peptide 1 OS=Homo sapiens OX=9606 GN=CALCA PE=1 SV=4
5	P10092	5.61e-41	135	127	0.560	0.622	CALCB_HUMAN Calcitonin gene-related peptide 2 OS=Homo sapiens OX=9606 GN=CALCB PE=1 SV=1
6	P01263	9.24e-35	119	136	0.447	0.463	CALC1_ONCKE Calcitonin-1 OS=Oncorhynchus keta OX=8018 PE=1 SV=1
7	P01256	1.33e-33	116	128	0.489	0.539	CALCA_RAT Calcitonin gene-related peptide 1 OS=Rattus norvegicus OX=10116 GN=Calca PE=2 SV=1
8	F1QIK6	3.03e-31	110	133	0.426	0.451	F1QIK6_DANRE Calcitonin gene-related peptide 2 isoform X1 OS=Danio rerio OX=7955 GN=calc PE=3 SV=1
9	Q99JA0	9.56e-22	86.3	128	0.482	0.531	CALCA_MOUSE Calcitonin gene-related peptide 1 OS=Mus musculus OX=10090 GN=Calca PE=2 SV=1
10	Q6DGJ9	1.12e-14	67.8	126	0.340	0.381	Q6DGJ9_DANRE Calca protein OS=Danio rerio OX=7955 GN=calc PE=2 SV=1
11	Q91157	2.21e-10	54.7	56	0.156	0.393	Q91157_ONCGO Calcitonin (Fragment) OS=Oncorhynchus gorbuscha OX=8017 GN=calc I PE=2 SV=1
12	Q24JL3	2.3	30.4	342	0.099	0.041	STR2_ARATH Thiosulfate/3-mercaptopyruvate sulfurtransferase 2 OS=Arabidopsis thaliana OX=3702 GN=STR2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00214 Calc_CGRP_IAPP	7.4e-29	112.4	Calcitonin / CGRP / IAPP family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000331746

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000254661	0.999	Receptor activity-modifying protein 1
2	9606.ENSP00000386972	0.999	Calcitonin gene-related peptide type 1 receptor
3	9606.ENSP00000352561	0.997	Calcitonin receptor
4	9606.ENSP00000253796	0.992	Receptor activity-modifying protein 2
5	9606.ENSP00000282091	0.975	Parathyroid hormone
6	9606.ENSP00000436607	0.974	ADM
7	9606.ENSP00000240652	0.973	Islet amyloid polypeptide
8	9606.ENSP00000242249	0.947	Receptor activity-modifying protein 3
9	9606.ENSP00000459962	0.925	Transient receptor potential cation channel, subfamily V, member 1
10	9606.ENSP00000356213	0.923	VIP peptides
11	9606.ENSP00000321106	0.917	Protachykinin-1
12	9606.ENSP00000461007	0.915	Transient receptor potential cation channel subfamily V member 1
13	9606.ENSP00000384364	0.878	Pro-neuropeptide Y
14	9606.ENSP00000379087	0.876	ADM2
15	9606.ENSP00000287641	0.870	Somatostatin
16	9606.ENSP00000220616	0.843	Thyroglobulin
17	9606.ENSP00000462647	0.841	Pituitary adenylate cyclase-activating polypeptide
18	9606.ENSP00000360141	0.840	Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas
19	9606.ENSP00000380432	0.839	Insulin
20	9606.ENSP00000441765	0.833	Parathyroid hormone-related protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031716	0.998	calcitonin receptor binding
GO:0042802	0.996	identical protein binding
GO:0098772	0.673	molecular function regulator activity
GO:0140677	0.631	molecular function activator activity
GO:0048018	0.557	receptor ligand activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.992	regulation of biological process
GO:0050896	0.989	response to stimulus
GO:0009987	0.988	cellular process
GO:0032501	0.983	multicellular organismal process
GO:0050794	0.983	regulation of cellular process
GO:0007154	0.978	cell communication
GO:0023052	0.976	signaling
GO:0051716	0.975	cellular response to stimulus
GO:0007165	0.937	signal transduction
GO:0032502	0.930	developmental process
GO:0048518	0.921	positive regulation of biological process
GO:0048519	0.914	negative regulation of biological process
GO:0051239	0.898	regulation of multicellular organismal process
GO:0007186	0.891	G protein-coupled receptor signaling pathway
GO:0065008	0.879	regulation of biological quality
GO:0051241	0.867	negative regulation of multicellular organismal process
GO:0042221	0.852	response to chemical
GO:1903522	0.851	regulation of blood circulation
GO:0044093	0.847	positive regulation of molecular function
GO:0008217	0.845	regulation of blood pressure
GO:0006954	0.840	inflammatory response
GO:0006937	0.826	regulation of muscle contraction
GO:0007188	0.826	adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0050790	0.816	regulation of catalytic activity
GO:0003018	0.812	vascular process in circulatory system
GO:0070887	0.792	cellular response to chemical stimulus
GO:0097746	0.783	blood vessel diameter maintenance
GO:0007189	0.780	adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0043085	0.779	positive regulation of catalytic activity
GO:0071495	0.757	cellular response to endogenous stimulus
GO:0009605	0.748	response to external stimulus
GO:0045776	0.706	negative regulation of blood pressure
GO:1990089	0.705	response to nerve growth factor
GO:0042311	0.703	vasodilation
GO:0048522	0.699	positive regulation of cellular process
GO:0048856	0.688	anatomical structure development
GO:0060255	0.671	regulation of macromolecule metabolic process
GO:0010604	0.635	positive regulation of macromolecule metabolic process
GO:0048523	0.633	negative regulation of cellular process
GO:0080090	0.631	regulation of primary metabolic process
GO:0051171	0.625	regulation of nitrogen compound metabolic process
GO:0071363	0.624	cellular response to growth factor stimulus
GO:0031323	0.617	regulation of cellular metabolic process
GO:0010468	0.615	regulation of gene expression
GO:0007275	0.517	multicellular organism development
GO:0010033	0.470	response to organic substance
GO:0031325	0.458	positive regulation of cellular metabolic process
GO:0051173	0.453	positive regulation of nitrogen compound metabolic process
GO:0051246	0.378	regulation of protein metabolic process
GO:1990090	0.374	cellular response to nerve growth factor stimulus
GO:0042592	0.335	homeostatic process
GO:0009892	0.327	negative regulation of metabolic process
GO:0009889	0.325	regulation of biosynthetic process
GO:0010556	0.324	regulation of macromolecule biosynthetic process
GO:0031326	0.324	regulation of cellular biosynthetic process
GO:0019219	0.324	regulation of nucleobase-containing compound metabolic process
GO:0051349	0.316	positive regulation of lyase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0005615	0.975	extracellular space
GO:0005622	0.933	intracellular anatomical structure
GO:0005737	0.828	cytoplasm
GO:0043226	0.822	organelle
GO:0043231	0.772	intracellular membrane-bounded organelle
GO:0016020	0.545	membrane
GO:0042995	0.512	cell projection
GO:0120025	0.503	plasma membrane bounded cell projection
GO:0030054	0.460	cell junction
GO:0012505	0.444	endomembrane system
GO:0070013	0.420	intracellular organelle lumen
GO:0031982	0.307	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]