StarFunc result for job id P01266

User Input

>input (1400 residues)
MALVLEIFTLLASICWVSANIFEYQVDAQPLRPCELQRETAFLKQADYVPQCAEDGSFQT
VQCQNDGRSCWCVGANGSEVLGSRQPGRPVACLSFCQLQKQQILLSGYINSTDTSYLPQC
QDSGDYAPVQCDVQQVQCWCVDAEGMEVYGTRQLGRPKRCPRSCEIRNRRLLHGVGDKSP
PQCSAEGEFMPVQCKFVNTTDMMIFDLVHSYNRFPDAFVTFSSFQRRFPEVSGYCHCADS
QGRELAETGLELLLDEIYDTIFAGLDLPSTFTETTLYRILQRRFLAVQSVISGRFRCPTK
CEVERFTATSFGHPYVPSCRRNGDYQAVQCQTEGPCWCVDAQGKEMHGTRQQGEPPSCAE
GQSCASERQQALSRLYFGTSGYFSQHDLFSSPEKRWASPRVARFATSCPPTIKELFVDSG
LLRPMVEGQSQQFSVSENLLKEAIRAIFPSRGLARLALQFTTNPKRLQQNLFGGKFLVNV
GQFNLSGALGTRGTFNFSQFFQQLGLASFLNGGRQEDLAKPLSVGLDSNSSTGTPEAAKK
DGTMNKPTVGSFGFEINLQENQNALKFLASLLELPEFLLFLQHAISVPEDVARDLGDVME
TVLSSQTCEQTPERLFVPSCTTEGSYEDVQCFSGECWCVNSWGKELPGSRVRGGQPRCPT
DCEKQRARMQSLMGSQPAGSTLFVPACTSEGHFLPVQCFNSECYCVDAEGQAIPGTRSAI
GKPKKCPTPCQLQSEQAFLRTVQALLSNSSMLPTLSDTYIPQCSTDGQWRQVQCNGPPEQ
VFELYQRWEAQNKGQDLTPAKLLVKIMSYREAASGNFSLFIQSLYEAGQQDVFPVLSQYP
SLQDVPLAALEGKRPQPRENILLEPYLFWQILNGQLSQYPGSYSDFSTPLAHFDLRNCWC
VDEAGQELEGMRSEPSKLPTCPGSCEEAKLRVLQFIRETEEIVSASNSSRFPLGESFLVA
KGIRLRNEDLGLPPLFPPREAFAEQFLRGSDYAIRLAAQSTLSFYQRRRFSPDDSAGASA
LLRSGPYMPQCDAFGSWEPVQCHAGTGHCWCVDEKGGFIPGSLTARSLQIPQCPTTCEKS
RTSGLLSSWKQARSQENPSPKDLFVPACLETGEYARLQASGAGTWCVDPASGEELRPGSS
SSAQCPSLCNVLKSGVLSRRVSPGYVPACRAEDGGFSPVQCDQAQGSCWCVMDSGEEVPG
TRVTGGQPACESPRCPLPFNASEVVGGTILCETISGPTGSAMQQCQLLCRQGSWSVFPPG
PLICSLESGRWESQLPQPRACQRPQLWQTIQTQGHFQLQLPPGKMCSADYADLLQTFQVF
ILDELTARGFCQIQVKTFGTLVSIPVCNNSSVQVGCLTRERLGVNVTWKSRLEDIPVASL
PDLHDIERALVGKDLLGRFT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1RRV3	0.471	0.257	0.000	2692	0.724	0.377	F1RRV3.pdb.gz	THYG_PIG Thyroglobulin OS=Sus scrofa OX=9823 GN=TG PE=1 SV=5
2	AFDB:X1WE42	0.056	0.052	1.296E-24	1576	0.119	0.105	X1WE42.pdb.gz
3	AFDB:O88322	0.061	0.061	8.264E-10	1403	0.039	0.038	O88322.pdb.gz	NID2_MOUSE Nidogen-2 OS=Mus musculus OX=10090 GN=Nid2 PE=1 SV=2
4	AFDB:Q8IV28	0.050	0.069	1.568E-9	969	0.044	0.064	Q8IV28.pdb.gz	Q8IV28_HUMAN NID2 protein OS=Homo sapiens OX=9606 GN=NID2 PE=1 SV=1
5	AFDB:Q14112	0.046	0.047	3.623E-9	1375	0.037	0.038	Q14112.pdb.gz	NID2_HUMAN Nidogen-2 OS=Homo sapiens OX=9606 GN=NID2 PE=1 SV=3
6	AFDB:Q0E9E0	0.069	0.138	2.730E-8	613	0.075	0.171	Q0E9E0.pdb.gz	Q0E9E0_DROME FI05255p OS=Drosophila melanogaster OX=7227 GN=magu PE=2 SV=1
7	AFDB:Q8CD91	0.079	0.164	8.477E-8	447	0.063	0.197	Q8CD91.pdb.gz	SMOC2_MOUSE SPARC-related modular calcium-binding protein 2 OS=Mus musculus OX=10090 GN=Smoc2 PE=1 SV=1
8	AFDB:E7EDQ9	0.065	0.159	2.905E-7	461	0.058	0.176	E7EDQ9.pdb.gz	E7EDQ9_DANRE SPARC-related modular calcium-binding 1 OS=Danio rerio OX=7955 GN=smoc1 PE=2 SV=1
9	AFDB:Q86MK1	0.065	0.144	3.051E-7	523	0.063	0.168	Q86MK1.pdb.gz	Q86MK1_DROME CG2264A OS=Drosophila melanogaster OX=7227 GN=magu PE=2 SV=1
10	AFDB:E7FET3	0.064	0.159	5.246E-7	437	0.058	0.185	E7FET3.pdb.gz
11	PDB:6pwnA	0.051	0.176	9.296E-2	280	0.015	0.075	6pwnA.pdb.gz
12	PDB:7sn8K	0.038	0.084	2.256E-1	588	0.006	0.015	7sn8K.pdb.gz	Inositol hexakisphosphate is required for Integrator function.
13	PDB:5mrcF	0.033	0.133	3.346E-1	196	0.013	0.092	5mrcF.pdb.gz	The structure of the yeast mitochondrial ribosome.
14	PDB:7aqcG	0.034	0.156	3.879E-1	175	0.010	0.080	7aqcG.pdb.gz	Mimicry of Canonical Translation Elongation Underlies Alanine Tail Synthesis in RQC.
15	PDB:7abzF	0.034	0.147	4.497E-1	176	0.010	0.080	7abzF.pdb.gz	Structures of tmRNA and SmpB as they transit through the ribosome.
16	PDB:6de7L	0.023	0.107	4.962E-1	208	0.011	0.077	6de7L.pdb.gz	Interdomain Stabilization Impairs CD4 Binding and Improves Immunogenicity of the HIV-1 Envelope Trimer.
17	PDB:6jwpJ	0.032	0.154	6.348E-1	144	0.011	0.104	6jwpJ.pdb.gz	Structural insights into the EGO-TC-mediated membrane tethering of the TORC1-regulatory Rag GTPases.
18	PDB:3cw2C	0.039	0.141	6.669E-1	266	0.008	0.041	3cw2C.pdb.gz	Crystal structure of the intact archaeal translation initiation factor 2 demonstrates very high conformational flexibility in the alpha- and beta-subunits.
19	PDB:6u3tB	0.028	0.105	6.669E-1	253	0.011	0.059	6u3tB.pdb.gz	Structure-based discovery of a small-molecule inhibitor of methicillin-resistantStaphylococcus aureusvirulence.
20	PDB:5jowA	0.036	0.061	7.359E-1	504	0.022	0.062	5jowA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A193GP06	0.0	1103	2733	0.426	0.218	A0A193GP06_DANRE Thyroglobulin OS=Danio rerio OX=7955 GN=Tg PE=1 SV=1
2	F1RRV3	0.0	1870	2692	0.662	0.344	THYG_PIG Thyroglobulin OS=Sus scrofa OX=9823 GN=TG PE=1 SV=5
3	O08710	0.0	2117	2766	0.739	0.374	THYG_MOUSE Thyroglobulin OS=Mus musculus OX=10090 GN=Tg PE=1 SV=3
4	P01266	0.0	2876	2768	1.000	0.506	THYG_HUMAN Thyroglobulin OS=Homo sapiens OX=9606 GN=TG PE=1 SV=5
5	P01267	0.0	2159	2769	0.759	0.384	THYG_BOVIN Thyroglobulin OS=Bos taurus OX=9913 GN=TG PE=1 SV=1
6	P06882	0.0	2122	2768	0.742	0.375	THYG_RAT Thyroglobulin OS=Rattus norvegicus OX=10116 GN=Tg PE=1 SV=4
7	A0A4X1WD80	7.97e-17	89.4	1348	0.036	0.037	A0A4X1WD80_PIG Nidogen 2 OS=Sus scrofa OX=9823 GN=NID2 PE=4 SV=1
8	B5DFC9	2.38e-15	84.3	1396	0.034	0.034	NID2_RAT Nidogen-2 OS=Rattus norvegicus OX=10116 GN=Nid2 PE=2 SV=1
9	Q14112	2.67e-15	84.3	1375	0.035	0.036	NID2_HUMAN Nidogen-2 OS=Homo sapiens OX=9606 GN=NID2 PE=1 SV=3
10	O88322	3.18e-15	84.0	1403	0.033	0.033	NID2_MOUSE Nidogen-2 OS=Mus musculus OX=10090 GN=Nid2 PE=1 SV=2
11	Q8IV28	3.33e-15	83.6	969	0.035	0.051	Q8IV28_HUMAN NID2 protein OS=Homo sapiens OX=9606 GN=NID2 PE=1 SV=1
12	Q9H3U7	7.82e-13	74.7	446	0.044	0.137	SMOC2_HUMAN SPARC-related modular calcium-binding protein 2 OS=Homo sapiens OX=9606 GN=SMOC2 PE=1 SV=2
13	Q8CD91	1.44e-11	70.9	447	0.041	0.130	SMOC2_MOUSE SPARC-related modular calcium-binding protein 2 OS=Mus musculus OX=10090 GN=Smoc2 PE=1 SV=1
14	Q9H4F8	1.77e-09	64.3	434	0.039	0.124	SMOC1_HUMAN SPARC-related modular calcium-binding protein 1 OS=Homo sapiens OX=9606 GN=SMOC1 PE=1 SV=1
15	Q0E9E0	3.35e-09	63.9	613	0.059	0.134	Q0E9E0_DROME FI05255p OS=Drosophila melanogaster OX=7227 GN=magu PE=2 SV=1
16	Q95TQ2	3.50e-09	63.5	613	0.059	0.134	Q95TQ2_DROME LD30894p OS=Drosophila melanogaster OX=7227 GN=magu PE=2 SV=1
17	E7EDQ9	8.48e-09	62.0	461	0.042	0.128	E7EDQ9_DANRE SPARC-related modular calcium-binding 1 OS=Danio rerio OX=7955 GN=smoc1 PE=2 SV=1
18	Q8BLY1	2.58e-08	60.5	463	0.041	0.123	SMOC1_MOUSE SPARC-related modular calcium-binding protein 1 OS=Mus musculus OX=10090 GN=Smoc1 PE=2 SV=2
19	Q9PUT2	5.24e-07	54.7	237	0.019	0.114	Q9PUT2_DANRE CD74 molecule, major histocompatibility complex, class II invariant chain a OS=Danio rerio OX=7955 GN=iclp1 PE=2 SV=1
20	P14543	2.44e-06	54.7	1247	0.020	0.022	NID1_HUMAN Nidogen-1 OS=Homo sapiens OX=9606 GN=NID1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02736 Myosin_N	6.3e+02	11.5	Myosin N-terminal SH3-like domain
2	PF00086 Thyroglobulin_1	1.6e-125	420.1	Thyroglobulin type-1 repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000220616

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263816	0.995	Low-density lipoprotein receptor-related protein 2
2	9606.ENSP00000318820	0.929	Thyroid peroxidase
3	9606.ENSP00000269299	0.912	Asialoglycoprotein receptor 1
4	9606.ENSP00000380489	0.910	Myoglobin
5	9606.ENSP00000441235	0.895	Thyrotropin receptor
6	9606.ENSP00000222248	0.866	Sodium/iodide cotransporter
7	9606.ENSP00000346879	0.850	Homeobox protein Nkx-2.1
8	9606.ENSP00000331746	0.843	Calcitonin
9	9606.ENSP00000263334	0.837	Paired box protein Pax-8
10	9606.ENSP00000259870	0.822	Uncharacterized protein C6orf15
11	9606.ENSP00000450980	0.820	Responsible for the deiodination of T4 (3,5,3',5'- tetraiodothyronine)
12	9606.ENSP00000327801	0.818	Protein disulfide-isomerase
13	9606.ENSP00000286091	0.808	Protein disulfide-isomerase A4
14	9606.ENSP00000347140	0.803	Asialoglycoprotein receptor 2
15	9606.ENSP00000237014	0.799	Transthyretin
16	9606.ENSP00000329374	0.793	Thyroxine-binding globulin
17	9606.ENSP00000295897	0.772	Serum albumin
18	9606.ENSP00000354280	0.760	Trypsin-3
19	9606.ENSP00000256637	0.745	Sortilin
20	9606.ENSP00000379904	0.731	Thyroid hormone receptor beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0010817	0.979	regulation of hormone levels
GO:1901360	0.976	organic cyclic compound metabolic process
GO:0006725	0.975	cellular aromatic compound metabolic process
GO:0018958	0.973	phenol-containing compound metabolic process
GO:0006575	0.971	cellular modified amino acid metabolic process
GO:0042445	0.934	hormone metabolic process
GO:0032501	0.671	multicellular organismal process
GO:0050789	0.440	regulation of biological process
GO:0050794	0.382	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]