StarFunc result for job id P01270

User Input

>input (115 residues)
MIPAKDMAKVMIVMLAICFLTKSDGKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQ
DVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P01270	1.000	1.000	1.653E-17	115	1.000	1.000	P01270.pdb.gz	PTHY_HUMAN Parathyroid hormone OS=Homo sapiens OX=9606 GN=PTH PE=1 SV=1
2	AFDB:Q1L5E8	0.315	0.196	8.916E-2	198	0.200	0.116	Q1L5E8.pdb.gz	Q1L5E8_DANRE Parathyroid hormone-related peptide 1 OS=Danio rerio OX=7955 GN=pthrp PE=2 SV=1
3	AFDB:Q2PJ98	0.161	0.087	1.414	248	0.174	0.081	Q2PJ98.pdb.gz	Q2PJ98_CAEEL Dickkopf_N domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_F52E1.5 PE=4 SV=1
4	AFDB:F8W5H1	0.233	0.054	1.769	639	0.148	0.027	F8W5H1.pdb.gz
5	AFDB:Q9LH85	0.187	0.187	1.906	115	0.148	0.148	Q9LH85.pdb.gz	RLA23_ARATH Large ribosomal subunit protein P2x OS=Arabidopsis thaliana OX=3702 GN=RPP2C PE=1 SV=1
6	AFDB:Q9XUE7	0.334	0.095	2.054	508	0.165	0.037	Q9XUE7.pdb.gz	CFP1_CAEEL CXXC-type zinc finger protein 1 OS=Caenorhabditis elegans OX=6239 GN=cfp-1 PE=1 SV=3
7	AFDB:P18908	0.242	0.212	2.769	140	0.157	0.129	P18908.pdb.gz	ANF_CHICK Natriuretic peptides A OS=Gallus gallus OX=9031 GN=NPPA PE=1 SV=2
8	AFDB:Q9FIS1	0.225	0.131	3.464	210	0.174	0.095	Q9FIS1.pdb.gz	AGL42_ARATH MADS-box protein AGL42 OS=Arabidopsis thaliana OX=3702 GN=AGL42 PE=1 SV=1
9	AFDB:Q57YN7	0.183	0.031	3.733	899	0.139	0.018	Q57YN7.pdb.gz	Q57YN7_TRYB2 B30.2/SPRY domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.11J15.230 PE=4 SV=1
10	PDB:6lss4	0.228	0.049	3.823	620	0.226	0.042	6lss4.pdb.gz	Structural snapshots of human pre-60S ribosomal particles before and after nuclear export.
11	AFDB:X2JEA7	0.272	0.102	4.022	420	0.174	0.048	X2JEA7.pdb.gz	X2JEA7_DROME Rab11 interacting protein, isoform C OS=Drosophila melanogaster OX=7227 GN=Rip11 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P01270	5.36e-81	234	115	1.000	1.000	PTHY_HUMAN Parathyroid hormone OS=Homo sapiens OX=9606 GN=PTH PE=1 SV=1
2	P04089	1.04e-56	173	115	0.713	0.713	PTHY_RAT Parathyroid hormone OS=Rattus norvegicus OX=10116 GN=Pth PE=2 SV=1
3	Q9Z0L6	9.40e-55	168	115	0.678	0.678	Q9Z0L6_MOUSE Parathyroid hormone OS=Mus musculus OX=10090 GN=Pth PE=1 SV=1
4	Q6WQ24	2.29e-09	52.8	99	0.243	0.283	Q6WQ24_DANRE Parathyroid hormone OS=Danio rerio OX=7955 GN=pth2 PE=2 SV=1
5	Q6WQ25	8.64e-07	45.8	102	0.174	0.196	Q6WQ25_DANRE Parathyroid hormone OS=Danio rerio OX=7955 GN=pth1 PE=2 SV=1
6	A0A1L2F565	0.004	36.6	121	0.157	0.149	PTH4_DANRE Parathyroid hormone 4 OS=Danio rerio OX=7955 GN=pth4 PE=2 SV=1
7	Q1L5E8	0.005	37.0	198	0.165	0.096	Q1L5E8_DANRE Parathyroid hormone-related peptide 1 OS=Danio rerio OX=7955 GN=pthrp PE=2 SV=1
8	Q5SPK3	0.006	37.0	198	0.165	0.096	Q5SPK3_DANRE Parathyroid hormone-like hormone OS=Danio rerio OX=7955 GN=pthlh PE=2 SV=1
9	P22858	0.13	32.7	175	0.148	0.097	PTHR_MOUSE Parathyroid hormone-related protein OS=Mus musculus OX=10090 GN=Pthlh PE=2 SV=1
10	P13085	0.14	32.7	177	0.148	0.096	PTHR_RAT Parathyroid hormone-related protein OS=Rattus norvegicus OX=10116 GN=Pthlh PE=2 SV=1
11	Q53XY9	0.28	32.0	175	0.148	0.097	Q53XY9_HUMAN Parathyroid hormone-related protein OS=Homo sapiens OX=9606 GN=PTHLH PE=2 SV=1
12	F5GZD9	0.30	32.0	172	0.148	0.099	F5GZD9_HUMAN Parathyroid hormone-related protein (Fragment) OS=Homo sapiens OX=9606 GN=PTHLH PE=1 SV=1
13	Q1L5E7	0.30	32.0	162	0.130	0.093	Q1L5E7_DANRE Parathyroid hormone-like hormone b OS=Danio rerio OX=7955 GN=pthrp2 PE=2 SV=1
14	P12272	0.31	32.0	177	0.148	0.096	PTHR_HUMAN Parathyroid hormone-related protein OS=Homo sapiens OX=9606 GN=PTHLH PE=1 SV=1
15	Q5TLZ2	0.97	30.4	178	0.165	0.107	Q5TLZ2_CHICK Parathyroid hormone like hormone OS=Gallus gallus OX=9031 GN=PTHrP PE=2 SV=1
16	P17251	0.98	30.4	176	0.165	0.108	PTHR_CHICK Parathyroid hormone-related protein OS=Gallus gallus OX=9031 GN=PTHLH PE=1 SV=1
17	Q08CJ9	2.6	29.6	628	0.191	0.035	Q08CJ9_DANRE Syntabulin OS=Danio rerio OX=7955 GN=zgc:153017 PE=2 SV=1
18	D3KVM2	3.3	29.3	506	0.191	0.043	D3KVM2_DANRE Syntabulin OS=Danio rerio OX=7955 GN=syn PE=4 SV=1
19	Q6QIY3	5.2	28.9	1958	0.087	0.005	SCNAA_MOUSE Sodium channel protein type 10 subunit alpha OS=Mus musculus OX=10090 GN=Scn10a PE=1 SV=2
20	Q7YRI2	5.8	28.1	170	0.139	0.094	Q7YRI2_CEREL Parathyroid hormone-related protein (Fragment) OS=Cervus elaphus OX=9860 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09818 ABC_ATPase	86	13.6	ATPase of the ABC class
2	PF01279 Parathyroid	0.00076	31.5	Parathyroid hormone family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000282091

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000321999	0.999	Parathyroid hormone/parathyroid hormone-related peptide receptor
2	9606.ENSP00000441765	0.993	Parathyroid hormone-related protein
3	9606.ENSP00000331746	0.975	Calcitonin
4	9606.ENSP00000272847	0.974	Parathyroid hormone 2 receptor
5	9606.ENSP00000270631	0.959	Tuberoinfundibular peptide of 39 residues
6	9606.ENSP00000237837	0.920	Fibroblast growth factor 23
7	9606.ENSP00000357255	0.916	Osteocalcin
8	9606.ENSP00000261349	0.914	Low-density lipoprotein receptor-related protein 6
9	9606.ENSP00000420194	0.913	Extracellular calcium-sensing receptor
10	9606.ENSP00000447173	0.897	Vitamin D3 receptor
11	9606.ENSP00000369442	0.884	Klotho
12	9606.ENSP00000301691	0.882	Sclerostin
13	9606.ENSP00000381775	0.877	Tumor necrosis factor ligand superfamily member 11
14	9606.ENSP00000295897	0.870	Serum albumin
15	9606.ENSP00000297350	0.846	Tumor necrosis factor receptor superfamily member 11B
16	9606.ENSP00000356213	0.845	VIP peptides
17	9606.ENSP00000228606	0.839	25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial
18	9606.ENSP00000387662	0.838	Glucagon
19	9606.ENSP00000384092	0.827	Pro-opiomelanocortin
20	9606.ENSP00000302665	0.814	Insulin-like growth factor I

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0001664	1.000	G protein-coupled receptor binding
GO:0051428	1.000	peptide hormone receptor binding
GO:0005179	1.000	hormone activity
GO:0031857	0.919	type 1 parathyroid hormone receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050794	0.993	regulation of cellular process
GO:0050896	0.990	response to stimulus
GO:0032501	0.981	multicellular organismal process
GO:0007165	0.975	signal transduction
GO:0031325	0.972	positive regulation of cellular metabolic process
GO:0010556	0.963	regulation of macromolecule biosynthetic process
GO:0010604	0.941	positive regulation of macromolecule metabolic process
GO:0007186	0.941	G protein-coupled receptor signaling pathway
GO:0010468	0.939	regulation of gene expression
GO:0080090	0.937	regulation of primary metabolic process
GO:0048519	0.934	negative regulation of biological process
GO:0071704	0.932	organic substance metabolic process
GO:0031326	0.930	regulation of cellular biosynthetic process
GO:0007189	0.925	adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0048523	0.916	negative regulation of cellular process
GO:0044238	0.910	primary metabolic process
GO:0051239	0.901	regulation of multicellular organismal process
GO:0032502	0.900	developmental process
GO:0044237	0.899	cellular metabolic process
GO:0050793	0.891	regulation of developmental process
GO:0048856	0.890	anatomical structure development
GO:0051171	0.884	regulation of nitrogen compound metabolic process
GO:0042221	0.883	response to chemical
GO:0010033	0.867	response to organic substance
GO:0009891	0.860	positive regulation of biosynthetic process
GO:0051173	0.857	positive regulation of nitrogen compound metabolic process
GO:0042592	0.853	homeostatic process
GO:0006807	0.850	nitrogen compound metabolic process
GO:0051240	0.841	positive regulation of multicellular organismal process
GO:0001503	0.838	ossification
GO:0009719	0.832	response to endogenous stimulus
GO:0043170	0.779	macromolecule metabolic process
GO:0051094	0.771	positive regulation of developmental process
GO:0050790	0.762	regulation of catalytic activity
GO:0019219	0.756	regulation of nucleobase-containing compound metabolic process
GO:2000026	0.749	regulation of multicellular organismal development
GO:2001141	0.736	regulation of RNA biosynthetic process
GO:0006355	0.731	regulation of DNA-templated transcription
GO:0007275	0.725	multicellular organism development
GO:1901564	0.691	organonitrogen compound metabolic process
GO:0006109	0.681	regulation of carbohydrate metabolic process
GO:0045893	0.677	positive regulation of DNA-templated transcription
GO:0030278	0.671	regulation of ossification
GO:0048731	0.665	system development
GO:0070167	0.665	regulation of biomineral tissue development
GO:0010675	0.662	regulation of cellular carbohydrate metabolic process
GO:0030500	0.661	regulation of bone mineralization
GO:0044093	0.644	positive regulation of molecular function
GO:1901360	0.626	organic cyclic compound metabolic process
GO:0062012	0.588	regulation of small molecule metabolic process
GO:0045778	0.573	positive regulation of ossification
GO:0030501	0.562	positive regulation of bone mineralization
GO:0032879	0.520	regulation of localization
GO:0010906	0.520	regulation of glucose metabolic process
GO:0051336	0.511	regulation of hydrolase activity
GO:0051049	0.506	regulation of transport
GO:0043467	0.499	regulation of generation of precursor metabolites and energy
GO:0032881	0.498	regulation of polysaccharide metabolic process
GO:0009058	0.489	biosynthetic process
GO:0044281	0.488	small molecule metabolic process
GO:0019220	0.479	regulation of phosphate metabolic process
GO:0070873	0.472	regulation of glycogen metabolic process
GO:0042127	0.467	regulation of cell population proliferation
GO:0032885	0.466	regulation of polysaccharide biosynthetic process
GO:0045913	0.463	positive regulation of carbohydrate metabolic process
GO:0023051	0.462	regulation of signaling
GO:0010646	0.460	regulation of cell communication
GO:0006725	0.459	cellular aromatic compound metabolic process
GO:0043085	0.455	positive regulation of catalytic activity
GO:0009150	0.451	purine ribonucleotide metabolic process
GO:0052652	0.442	cyclic purine nucleotide metabolic process
GO:0010676	0.439	positive regulation of cellular carbohydrate metabolic process
GO:0060191	0.421	regulation of lipase activity
GO:0048878	0.409	chemical homeostasis
GO:0007267	0.402	cell-cell signaling
GO:0006357	0.395	regulation of transcription by RNA polymerase II
GO:0048583	0.381	regulation of response to stimulus
GO:0046058	0.374	cAMP metabolic process
GO:0010962	0.371	regulation of glucan biosynthetic process
GO:0009966	0.363	regulation of signal transduction
GO:0070887	0.361	cellular response to chemical stimulus
GO:0071310	0.353	cellular response to organic substance
GO:0045595	0.349	regulation of cell differentiation
GO:0009892	0.344	negative regulation of metabolic process
GO:0062013	0.336	positive regulation of small molecule metabolic process
GO:0010605	0.332	negative regulation of macromolecule metabolic process
GO:1901576	0.320	organic substance biosynthetic process
GO:0010907	0.300	positive regulation of glucose metabolic process
GO:0005979	0.300	regulation of glycogen biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0005615	0.841	extracellular space
GO:0071944	0.488	cell periphery
GO:0016020	0.454	membrane
GO:0043231	0.382	intracellular membrane-bounded organelle
GO:0005737	0.337	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]