StarFunc result for job id P01275

User Input

>input (180 residues)
MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTS
DYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFI
AWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P01272	0.497	0.497	3.024E-26	180	0.917	0.917	P01272.pdb.gz	GLUC_BOVIN Pro-glucagon OS=Bos taurus OX=9913 GN=GCG PE=1 SV=1
2	AFDB:P06883	0.511	0.511	2.537E-24	180	0.911	0.911	P06883.pdb.gz	GLUC_RAT Pro-glucagon OS=Rattus norvegicus OX=10116 GN=Gcg PE=1 SV=1
3	AFDB:P68259	0.308	0.278	9.015E-19	206	0.744	0.650	P68259.pdb.gz	GLUC_CHICK Pro-glucagon OS=Gallus gallus OX=9031 GN=GCG PE=1 SV=1
4	AFDB:P53168	0.188	0.141	1.998E-1	247	0.133	0.097	P53168.pdb.gz	DUO1_YEAST DASH complex subunit DUO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DUO1 PE=1 SV=1
5	AFDB:Q63Z96	0.171	0.191	3.322E-1	157	0.183	0.210	Q63Z96.pdb.gz	Q63Z96_ARATH At1g76060 OS=Arabidopsis thaliana OX=3702 GN=EMB1793 PE=1 SV=1
6	AFDB:Q9VUX7	0.183	0.099	1.228	377	0.150	0.072	Q9VUX7.pdb.gz	Q9VUX7_DROME GH16214p OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
7	AFDB:Q8I641	0.173	0.098	1.526	345	0.128	0.067	Q8I641.pdb.gz	Q8I641_PLAF7 Rifin OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1200300 PE=4 SV=1
8	AFDB:P08082	0.142	0.122	1.765	229	0.111	0.087	P08082.pdb.gz	CLCB_RAT Clathrin light chain B OS=Rattus norvegicus OX=10116 GN=Cltb PE=1 SV=1
9	AFDB:Q10492	0.177	0.164	1.765	197	0.144	0.132	Q10492.pdb.gz	PNN1_SCHPO Pinin homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pnn1 PE=3 SV=1
10	AFDB:Q8IJ05	0.163	0.093	1.765	348	0.100	0.052	Q8IJ05.pdb.gz	Q8IJ05_PLAF7 Rifin OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1040400 PE=4 SV=1
11	PDB:7yyhK	0.186	0.164	4.551	217	0.144	0.120	7yyhK.pdb.gz	Structure of the human inner kinetochore bound to a centromeric CENP-A nucleosome.
12	PDB:5lj5O	0.143	0.096	4.894	283	0.144	0.092	5lj5O.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P01275	4.37e-134	374	180	1.000	1.000	GLUC_HUMAN Pro-glucagon OS=Homo sapiens OX=9606 GN=GCG PE=1 SV=3
2	P06883	6.76e-124	348	180	0.911	0.911	GLUC_RAT Pro-glucagon OS=Rattus norvegicus OX=10116 GN=Gcg PE=1 SV=1
3	P01272	8.99e-124	348	180	0.917	0.917	GLUC_BOVIN Pro-glucagon OS=Bos taurus OX=9913 GN=GCG PE=1 SV=1
4	P01274	2.85e-123	346	180	0.911	0.911	GLUC_PIG Pro-glucagon OS=Sus scrofa OX=9823 GN=GCG PE=1 SV=4
5	P55095	1.21e-121	342	180	0.900	0.900	GLUC_MOUSE Pro-glucagon OS=Mus musculus OX=10090 GN=Gcg PE=1 SV=1
6	P68259	9.28e-99	285	206	0.744	0.650	GLUC_CHICK Pro-glucagon OS=Gallus gallus OX=9031 GN=GCG PE=1 SV=1
7	Q3HWX0	9.28e-99	285	206	0.744	0.650	Q3HWX0_CHICK Preproglucagon B OS=Gallus gallus OX=9031 GN=GCG PE=2 SV=1
8	A0A0R4IS85	9.18e-44	145	176	0.433	0.443	A0A0R4IS85_DANRE Glucagon a OS=Danio rerio OX=7955 GN=gcg PE=3 SV=1
9	F1RD10	8.83e-32	112	121	0.344	0.512	F1RD10_DANRE Glucagon a OS=Danio rerio OX=7955 GN=gcg PE=3 SV=1
10	P01282	5.89e-08	52.0	170	0.161	0.171	VIP_HUMAN VIP peptides OS=Homo sapiens OX=9606 GN=VIP PE=1 SV=1
11	P81401	8.22e-07	48.9	170	0.156	0.165	VIP_BOVIN VIP peptides OS=Bos taurus OX=9913 GN=VIP PE=1 SV=2
12	B8JIU2	6.25e-06	46.2	153	0.167	0.196	B8JIU2_DANRE VIP peptides OS=Danio rerio OX=7955 GN=vip1 PE=3 SV=1
13	P32648	1.07e-05	45.8	170	0.122	0.129	VIP_MOUSE VIP peptides OS=Mus musculus OX=10090 GN=Vip PE=1 SV=1
14	P01283	1.63e-05	45.4	170	0.122	0.129	VIP_RAT VIP peptides OS=Rattus norvegicus OX=10116 GN=Vip PE=1 SV=2
15	Q06145	5.90e-05	43.5	144	0.117	0.146	GIP_RAT Gastric inhibitory polypeptide OS=Rattus norvegicus OX=10116 GN=Gip PE=2 SV=2
16	P09681	9.66e-05	42.7	153	0.144	0.170	GIP_HUMAN Gastric inhibitory polypeptide OS=Homo sapiens OX=9606 GN=GIP PE=1 SV=1
17	Q58FG9	1.31e-04	42.7	172	0.172	0.180	Q58FG9_CHICK Adenylate cyclase activating polypeptide 1 OS=Gallus gallus OX=9031 GN=PACAP PE=2 SV=1
18	P41534	1.42e-04	42.7	175	0.172	0.177	PACA_CHICK Glucagon family neuropeptides OS=Gallus gallus OX=9031 GN=ADCYAP1 PE=1 SV=2
19	P48756	1.50e-04	42.4	144	0.128	0.160	GIP_MOUSE Gastric inhibitory polypeptide OS=Mus musculus OX=10090 GN=Gip PE=2 SV=2
20	P01281	7.95e-04	38.1	42	0.089	0.381	GIP_PIG Gastric inhibitory polypeptide OS=Sus scrofa OX=9823 GN=GIP PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00123 Hormone_2	1.3e-41	151.3	Peptide hormone
2	PF03202 Lipoprotein_10	1.2	21.0	Putative mycoplasma lipoprotein, C-terminal region
3	PF17234 MPM1	1.1e+02	14.5	Mitochondrial peculiar membrane protein 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003820986.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003831155.1	0.994	Belongs to the G-protein coupled receptor 2 family.
2	9597.XP_003818925.1	0.993	Glucagon-like peptide 1 receptor isoform X1
3	9597.XP_003818139.1	0.982	Belongs to the G-protein coupled receptor 2 family.
4	9597.XP_008948937.1	0.965	Belongs to the peptidase M16 family.
5	9597.XP_008969106.1	0.961	Belongs to the G-protein coupled receptor 2 family.
6	9597.XP_003818990.1	0.928	Belongs to the G-protein coupled receptor 1 family.
7	9597.XP_008967680.1	0.902	Vasoactive intestinal polypeptide receptor 2
8	9597.XP_003820987.1	0.895	Belongs to the peptidase S9B family.
9	9597.XP_008961425.1	0.892	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 4225 ESTs, 2 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 18 samples with support for all annotated introns
10	9597.XP_003806093.1	0.868	Key player in the regulation of energy balance and body weight control. Once released into the circulation, has central and peripheral effects by binding LEPR, found in many tissues, which results in the activation of several major signaling pathways. In the hypothalamus, acts as an appetite-regulating factor that induces a decrease in food intake and an increase in energy consumption by inducing anorexinogenic factors and suppressing orexigenic neuropeptides, also regulates bone mass and secretion of hypothalamo- pituitary-adrenal hormones. In the periphery, increases basal metabolism [...]
11	9597.XP_008955320.1	0.855	G protein subunit gamma 2
12	9597.XP_003807342.1	0.838	G protein subunit beta 1
13	9597.XP_003826334.1	0.828	Ghrelin and obestatin prepropeptide
14	9597.XP_003806688.1	0.826	Somatostatin
15	9597.XP_008972658.1	0.813	Belongs to the peptidase S9B family.
16	9597.XP_003822795.1	0.803	G protein subunit alpha transducin 3
17	9597.XP_003813899.1	0.790	Gastrin
18	9597.XP_008974584.1	0.787	Guanine nucleotide-binding protein G(i) subunit alpha-1 isoform X1
19	9597.XP_003816114.1	0.784	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
20	9597.XP_003811745.2	0.783	G protein subunit alpha L

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005179	1.000	hormone activity
GO:0001664	0.999	G protein-coupled receptor binding
GO:0031769	0.480	glucagon receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0050896	0.994	response to stimulus
GO:0050794	0.994	regulation of cellular process
GO:0009987	0.992	cellular process
GO:0007154	0.971	cell communication
GO:0051716	0.971	cellular response to stimulus
GO:0023052	0.968	signaling
GO:0007186	0.959	G protein-coupled receptor signaling pathway
GO:0032501	0.915	multicellular organismal process
GO:0048583	0.898	regulation of response to stimulus
GO:0006109	0.881	regulation of carbohydrate metabolic process
GO:0008152	0.842	metabolic process
GO:0023051	0.814	regulation of signaling
GO:0048518	0.795	positive regulation of biological process
GO:0071704	0.790	organic substance metabolic process
GO:0065008	0.782	regulation of biological quality
GO:0044238	0.779	primary metabolic process
GO:0010646	0.763	regulation of cell communication
GO:0048522	0.750	positive regulation of cellular process
GO:0048519	0.729	negative regulation of biological process
GO:0031323	0.715	regulation of cellular metabolic process
GO:0009893	0.688	positive regulation of metabolic process
GO:0031325	0.676	positive regulation of cellular metabolic process
GO:0048585	0.642	negative regulation of response to stimulus
GO:0009605	0.594	response to external stimulus
GO:0062012	0.567	regulation of small molecule metabolic process
GO:0032101	0.504	regulation of response to external stimulus
GO:0062013	0.495	positive regulation of small molecule metabolic process
GO:0044281	0.489	small molecule metabolic process
GO:0032098	0.479	regulation of appetite
GO:0010675	0.477	regulation of cellular carbohydrate metabolic process
GO:0042221	0.464	response to chemical
GO:0009889	0.462	regulation of biosynthetic process
GO:0010907	0.460	positive regulation of glucose metabolic process
GO:0060255	0.450	regulation of macromolecule metabolic process
GO:0032107	0.446	regulation of response to nutrient levels
GO:0032095	0.434	regulation of response to food
GO:0044237	0.418	cellular metabolic process
GO:0048523	0.406	negative regulation of cellular process
GO:0009966	0.405	regulation of signal transduction
GO:0051171	0.397	regulation of nitrogen compound metabolic process
GO:0010647	0.308	positive regulation of cell communication
GO:0048584	0.303	positive regulation of response to stimulus
GO:0010604	0.303	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0012505	0.996	endomembrane system
GO:0070013	0.996	intracellular organelle lumen
GO:0005737	0.989	cytoplasm
GO:0031982	0.973	vesicle
GO:0005615	0.914	extracellular space
GO:0031410	0.729	cytoplasmic vesicle
GO:0099503	0.557	secretory vesicle
GO:0030141	0.516	secretory granule
GO:0016020	0.504	membrane
GO:0031983	0.344	vesicle lumen
GO:0071944	0.303	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]