StarFunc result for job id P01282

User Input

>input (170 residues)
MDTRNKAQLLVLLTLLSVLFSQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDM
LQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPV
PVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELEK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P01282	1.000	1.000	4.983E-25	170	1.000	1.000	P01282.pdb.gz	VIP_HUMAN VIP peptides OS=Homo sapiens OX=9606 GN=VIP PE=1 SV=1
2	AFDB:P01283	0.438	0.438	9.519E-18	170	0.824	0.824	P01283.pdb.gz	VIP_RAT VIP peptides OS=Rattus norvegicus OX=10116 GN=Vip PE=1 SV=2
3	AFDB:P81401	0.492	0.492	2.646E-17	170	0.865	0.865	P81401.pdb.gz	VIP_BOVIN VIP peptides OS=Bos taurus OX=9913 GN=VIP PE=1 SV=2
4	AFDB:B4XV22	0.216	0.238	1.151E-4	153	0.453	0.503	B4XV22.pdb.gz
5	PDB:7emfK	0.167	0.229	2.161	112	0.118	0.179	7emfK.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
6	AFDB:Q9BRP8	0.138	0.116	2.764	204	0.106	0.088	Q9BRP8.pdb.gz	PYM1_HUMAN Partner of Y14 and mago OS=Homo sapiens OX=9606 GN=PYM1 PE=1 SV=1
7	AFDB:O96292	0.182	0.100	3.630	330	0.159	0.082	O96292.pdb.gz	O96292_PLAF7 Rifin OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0223100 PE=4 SV=3
8	AFDB:P45920	0.192	0.119	3.886	322	0.118	0.062	P45920.pdb.gz	YQBD_BACSU Uncharacterized protein YqbD OS=Bacillus subtilis (strain 168) OX=224308 GN=yqbD PE=1 SV=2
9	AFDB:Q7KQL1	0.199	0.043	3.886	915	0.159	0.030	Q7KQL1.pdb.gz	Q7KQL1_PLAF7 Pre-mRNA-splicing factor CEF1, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1033600 PE=3 SV=1
10	AFDB:Q8IP97	0.173	0.110	3.886	292	0.141	0.082	Q8IP97.pdb.gz	Q8IP97_DROME Peroxin-19 OS=Drosophila melanogaster OX=7227 GN=Pex19 PE=1 SV=2
11	AFDB:Q9ZPQ7	0.210	0.190	3.886	189	0.076	0.069	Q9ZPQ7.pdb.gz	Q9ZPQ7_ARATH At2g03740 OS=Arabidopsis thaliana OX=3702 GN=LEA11 PE=1 SV=1
12	PDB:7nvrb	0.201	0.241	3.991	136	0.135	0.169	7nvrb.pdb.gz	Structures of mammalian RNA polymerase II pre-initiation complexes.
13	PDB:4gwpA	0.200	0.268	6.007	112	0.094	0.143	4gwpA.pdb.gz
14	PDB:7enag	0.180	0.183	6.007	166	0.082	0.084	7enag.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
15	PDB:2hh7A	0.180	0.309	7.370	85	0.076	0.153	2hh7A.pdb.gz
16	PDB:5wlcNB	0.127	0.143	7.890	142	0.147	0.176	5wlcNB.pdb.gz	The complete structure of the small-subunit processome.
17	PDB:6gvwB	0.171	0.133	8.446	262	0.118	0.076	6gvwB.pdb.gz	Structural Basis of BRCC36 Function in DNA Repair and Immune Regulation.
18	PDB:6exnO	0.155	0.088	9.680	320	0.106	0.056	6exnO.pdb.gz	Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.
19	PDB:6igmH	0.152	0.079	9.680	373	0.088	0.040	6igmH.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P01282	2.45e-124	348	170	1.000	1.000	VIP_HUMAN VIP peptides OS=Homo sapiens OX=9606 GN=VIP PE=1 SV=1
2	P81401	1.09e-106	303	170	0.865	0.865	VIP_BOVIN VIP peptides OS=Bos taurus OX=9913 GN=VIP PE=1 SV=2
3	P01283	4.63e-102	292	170	0.824	0.824	VIP_RAT VIP peptides OS=Rattus norvegicus OX=10116 GN=Vip PE=1 SV=2
4	P32648	5.41e-98	281	170	0.794	0.794	VIP_MOUSE VIP peptides OS=Mus musculus OX=10090 GN=Vip PE=1 SV=1
5	P48143	4.29e-48	156	200	0.488	0.415	VIP_CHICK VIP peptides OS=Gallus gallus OX=9031 GN=VIP PE=1 SV=1
6	P45644	7.84e-47	153	200	0.476	0.405	VIP_MELGA VIP peptides OS=Meleagris gallopavo OX=9103 GN=VIP PE=2 SV=1
7	B8JIU2	5.23e-42	139	153	0.459	0.510	B8JIU2_DANRE VIP peptides OS=Danio rerio OX=7955 GN=vip1 PE=3 SV=1
8	P01284	2.03e-32	112	75	0.329	0.747	VIP_PIG VIP peptides (Fragment) OS=Sus scrofa OX=9823 GN=VIP PE=1 SV=2
9	Q58FG9	1.05e-25	98.6	172	0.318	0.314	Q58FG9_CHICK Adenylate cyclase activating polypeptide 1 OS=Gallus gallus OX=9031 GN=PACAP PE=2 SV=1
10	Q9DE29	2.49e-24	95.1	172	0.318	0.314	Q9DE29_DANRE Adenylate cyclase activating polypeptide 1a isoform 1 precursor OS=Danio rerio OX=7955 GN=GRF-PACAP PE=3 SV=1
11	P41534	8.20e-24	93.6	175	0.282	0.274	PACA_CHICK Glucagon family neuropeptides OS=Gallus gallus OX=9031 GN=ADCYAP1 PE=1 SV=2
12	Q5XJ29	3.26e-23	92.8	199	0.318	0.271	Q5XJ29_DANRE Adcyap1a protein OS=Danio rerio OX=7955 GN=GRF-PACAP PE=2 SV=1
13	F4MJ04	4.36e-20	82.0	107	0.300	0.477	F4MJ04_COLLI Vasoactive intestinal peptide (Fragment) OS=Columba livia OX=8932 GN=VIP PE=2 SV=1
14	Q98TU3	9.32e-19	80.5	175	0.265	0.257	Q98TU3_DANRE Adcyap1b protein OS=Danio rerio OX=7955 GN=PACAP2 PE=1 SV=1
15	P41535	2.18e-18	79.7	176	0.247	0.239	PACA_PIG Pituitary adenylate cyclase-activating polypeptide OS=Sus scrofa OX=9823 GN=ADCYAP1 PE=1 SV=3
16	O70176	7.68e-17	75.5	175	0.224	0.217	PACA_MOUSE Pituitary adenylate cyclase-activating polypeptide OS=Mus musculus OX=10090 GN=Adcyap1 PE=2 SV=1
17	P13589	6.28e-16	73.2	175	0.224	0.217	PACA_RAT Pituitary adenylate cyclase-activating polypeptide OS=Rattus norvegicus OX=10116 GN=Adcyap1 PE=1 SV=2
18	P16613	2.25e-15	71.6	176	0.229	0.222	PACA_SHEEP Pituitary adenylate cyclase-activating polypeptide OS=Ovis aries OX=9940 GN=ADCYAP1 PE=1 SV=1
19	P18509	5.08e-14	68.2	176	0.229	0.222	PACA_HUMAN Pituitary adenylate cyclase-activating polypeptide OS=Homo sapiens OX=9606 GN=ADCYAP1 PE=1 SV=3
20	P63289	9.27e-13	61.2	28	0.165	1.000	VIP_CANLF Vasoactive intestinal peptide OS=Canis lupus familiaris OX=9615 GN=VIP PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10945 CBP_BcsR	2.9e+02	12.5	Cellulose biosynthesis protein BcsR
2	PF13498 DUF4122	4.5e+02	11.8	Domain of unknown function (DUF4122)
3	PF00123 Hormone_2	5.7e-25	98.1	Peptide hormone
4	PF14389 Lzipper-MIP1	1.5e+02	14.1	Leucine-zipper of ternary complex factor MIP1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356213

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000327246	0.999	Vasoactive intestinal polypeptide receptor 1
2	9606.ENSP00000262178	0.998	Vasoactive intestinal polypeptide receptor 2
3	9606.ENSP00000362716	0.938	Somatoliberin
4	9606.ENSP00000176195	0.929	Secretin
5	9606.ENSP00000331746	0.923	Calcitonin
6	9606.ENSP00000321106	0.916	Protachykinin-1
7	9606.ENSP00000483721	0.916	Pituitary adenylate cyclase-activating polypeptide type I receptor
8	9606.ENSP00000379472	0.912	Cholecystokinin
9	9606.ENSP00000384364	0.910	Pro-neuropeptide Y
10	9606.ENSP00000287641	0.905	Somatostatin
11	9606.ENSP00000019103	0.850	Secretin receptor
12	9606.ENSP00000282091	0.845	Parathyroid hormone
13	9606.ENSP00000256857	0.843	Gastrin-releasing peptide
14	9606.ENSP00000256010	0.832	Neurotensin/neuromedin N
15	9606.ENSP00000216200	0.821	Parvalbumin alpha
16	9606.ENSP00000265643	0.813	Galanin peptides
17	9606.ENSP00000362353	0.813	Glucagon-like peptide 1 receptor
18	9606.ENSP00000331358	0.806	Gastrin
19	9606.ENSP00000384092	0.788	Pro-opiomelanocortin
20	9606.ENSP00000011653	0.786	T-cell surface glycoprotein CD4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005179	1.000	hormone activity
GO:0005184	0.916	neuropeptide hormone activity
GO:0051428	0.687	peptide hormone receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.997	response to stimulus
GO:0009987	0.997	cellular process
GO:0050794	0.997	regulation of cellular process
GO:0007165	0.989	signal transduction
GO:0007186	0.942	G protein-coupled receptor signaling pathway
GO:0007189	0.932	adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0048518	0.914	positive regulation of biological process
GO:0019222	0.884	regulation of metabolic process
GO:0042176	0.865	regulation of protein catabolic process
GO:0051247	0.865	positive regulation of protein metabolic process
GO:0032879	0.849	regulation of localization
GO:0009896	0.627	positive regulation of catabolic process
GO:0045732	0.605	positive regulation of protein catabolic process
GO:0060341	0.550	regulation of cellular localization
GO:0032880	0.490	regulation of protein localization
GO:0048522	0.425	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0005615	0.717	extracellular space
GO:0043226	0.666	organelle
GO:0005622	0.608	intracellular anatomical structure
GO:0016020	0.526	membrane
GO:0071944	0.487	cell periphery
GO:0036477	0.365	somatodendritic compartment
GO:0044297	0.332	cell body
GO:0043025	0.319	neuronal cell body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]