StarFunc result for job id P01286

User Input

>input (108 residues)
MPLWVFFFVILTLSNSSHCSPPPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSR
QQGESNQERGARARLGRQVDSMWAEQKQMELESILVALLQKHSRNSQG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P01286	1.000	1.000	2.855E-16	108	1.000	1.000	P01286.pdb.gz	SLIB_HUMAN Somatoliberin OS=Homo sapiens OX=9606 GN=GHRH PE=1 SV=1
2	AFDB:P02647	0.218	0.102	3.330	267	0.204	0.082	P02647.pdb.gz	APOA1_HUMAN Apolipoprotein A-I OS=Homo sapiens OX=9606 GN=APOA1 PE=1 SV=1
3	AFDB:Q9HDT8	0.470	0.230	3.616	247	0.120	0.053	Q9HDT8.pdb.gz	YJ51_SCHPO UPF0612 protein P20C8.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCP20C8.01c PE=3 SV=1
4	AFDB:Q9BZL4	0.378	0.086	3.927	782	0.204	0.028	Q9BZL4.pdb.gz	PP12C_HUMAN Protein phosphatase 1 regulatory subunit 12C OS=Homo sapiens OX=9606 GN=PPP1R12C PE=1 SV=1
5	AFDB:Q6NQV8	0.313	0.043	4.264	986	0.102	0.011	Q6NQV8.pdb.gz	Q6NQV8_DROME RH15640p OS=Drosophila melanogaster OX=7227 GN=wtrw PE=2 SV=1
6	PDB:6c0f8	0.390	0.427	4.344	98	0.056	0.061	6c0f8.pdb.gz	Modular assembly of the nucleolar pre-60S ribosomal subunit.
7	AFDB:Q91WK0	0.552	0.167	4.630	415	0.204	0.053	Q91WK0.pdb.gz	LRRF2_MOUSE Leucine-rich repeat flightless-interacting protein 2 OS=Mus musculus OX=10090 GN=Lrrfip2 PE=1 SV=1
8	AFDB:Q3TNL8	0.372	0.085	5.928	555	0.139	0.027	Q3TNL8.pdb.gz	IPRI_MOUSE Inositol 1,4,5-trisphosphate receptor-interacting protein OS=Mus musculus OX=10090 GN=Itprip PE=1 SV=1
9	AFDB:C8VB12	0.457	0.153	6.437	379	0.111	0.032	C8VB12.pdb.gz	C8VB12_EMENI Septin OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_04667 PE=3 SV=1
10	PDB:6w1sL	0.233	0.053	7.122	524	0.074	0.015	6w1sL.pdb.gz	A Pliable Mediator Acts as a Functional Rather Than an Architectural Bridge between Promoters and Enhancers.
11	AFDB:Q8R1L8	0.538	0.308	7.591	198	0.111	0.061	Q8R1L8.pdb.gz	ANGL8_MOUSE Angiopoietin-like protein 8 OS=Mus musculus OX=10090 GN=Angptl8 PE=2 SV=2
12	AFDB:Q9JMB0	0.396	0.160	7.591	366	0.204	0.060	Q9JMB0.pdb.gz	GKAP1_MOUSE G kinase-anchoring protein 1 OS=Mus musculus OX=10090 GN=Gkap1 PE=1 SV=1
13	PDB:7pzyt	0.153	0.102	7.733	200	0.046	0.025	7pzyt.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
14	PDB:7mqaSS	0.224	0.080	8.397	350	0.065	0.020	7mqaSS.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:5mqfO	0.193	0.054	9.901	564	0.065	0.012	5mqfO.pdb.gz	Cryo-EM structure of a human spliceosome activated for step 2 of splicing.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P01286	7.05e-77	223	108	1.000	1.000	SLIB_HUMAN Somatoliberin OS=Homo sapiens OX=9606 GN=GHRH PE=1 SV=1
2	P63292	1.72e-48	151	106	0.731	0.745	SLIB_BOVIN Somatoliberin OS=Bos taurus OX=9913 GN=GHRH PE=1 SV=1
3	P09916	6.96e-39	127	104	0.583	0.606	SLIB_RAT Somatoliberin OS=Rattus norvegicus OX=10116 GN=Ghrh PE=1 SV=2
4	P16043	4.17e-32	110	103	0.556	0.583	SLIB_MOUSE Somatoliberin OS=Mus musculus OX=10090 GN=Ghrh PE=3 SV=1
5	A0A181	1.57e-12	60.8	112	0.306	0.295	A0A181_DANRE Growth hormone-releasing hormone OS=Danio rerio OX=7955 GN=GHRH PE=2 SV=1
6	Q9DE29	4.84e-10	55.5	172	0.315	0.198	Q9DE29_DANRE Adenylate cyclase activating polypeptide 1a isoform 1 precursor OS=Danio rerio OX=7955 GN=GRF-PACAP PE=3 SV=1
7	Q58FG9	5.05e-10	55.5	172	0.278	0.174	Q58FG9_CHICK Adenylate cyclase activating polypeptide 1 OS=Gallus gallus OX=9031 GN=PACAP PE=2 SV=1
8	Q5XJ29	1.49e-09	54.7	199	0.306	0.166	Q5XJ29_DANRE Adcyap1a protein OS=Danio rerio OX=7955 GN=GRF-PACAP PE=2 SV=1
9	P41534	2.93e-09	53.5	175	0.269	0.166	PACA_CHICK Glucagon family neuropeptides OS=Gallus gallus OX=9031 GN=ADCYAP1 PE=1 SV=2
10	B8JIU2	2.65e-06	45.4	153	0.241	0.170	B8JIU2_DANRE VIP peptides OS=Danio rerio OX=7955 GN=vip1 PE=3 SV=1
11	P41535	1.21e-05	43.9	176	0.296	0.182	PACA_PIG Pituitary adenylate cyclase-activating polypeptide OS=Sus scrofa OX=9823 GN=ADCYAP1 PE=1 SV=3
12	P81401	1.26e-05	43.9	170	0.250	0.159	VIP_BOVIN VIP peptides OS=Bos taurus OX=9913 GN=VIP PE=1 SV=2
13	P01282	2.51e-05	43.1	170	0.250	0.159	VIP_HUMAN VIP peptides OS=Homo sapiens OX=9606 GN=VIP PE=1 SV=1
14	P01283	3.11e-05	42.7	170	0.241	0.153	VIP_RAT VIP peptides OS=Rattus norvegicus OX=10116 GN=Vip PE=1 SV=2
15	P32648	3.34e-05	42.7	170	0.241	0.153	VIP_MOUSE VIP peptides OS=Mus musculus OX=10090 GN=Vip PE=1 SV=1
16	P13589	6.22e-05	42.0	175	0.269	0.166	PACA_RAT Pituitary adenylate cyclase-activating polypeptide OS=Rattus norvegicus OX=10116 GN=Adcyap1 PE=1 SV=2
17	O70176	6.41e-05	42.0	175	0.278	0.171	PACA_MOUSE Pituitary adenylate cyclase-activating polypeptide OS=Mus musculus OX=10090 GN=Adcyap1 PE=2 SV=1
18	Q98TU3	1.38e-04	40.8	175	0.259	0.160	Q98TU3_DANRE Adcyap1b protein OS=Danio rerio OX=7955 GN=PACAP2 PE=1 SV=1
19	P16613	0.001	38.5	176	0.250	0.153	PACA_SHEEP Pituitary adenylate cyclase-activating polypeptide OS=Ovis aries OX=9940 GN=ADCYAP1 PE=1 SV=1
20	F4MJ04	0.004	36.2	107	0.185	0.187	F4MJ04_COLLI Vasoactive intestinal peptide (Fragment) OS=Columba livia OX=8932 GN=VIP PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00123 Hormone_2	4e-10	50.7	Peptide hormone

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362716

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000320180	0.997	Growth hormone-releasing hormone receptor
2	9606.ENSP00000335074	0.982	Appetite-regulating hormone
3	9606.ENSP00000287641	0.980	Somatostatin
4	9606.ENSP00000356213	0.938	VIP peptides
5	9606.ENSP00000276571	0.895	Corticoliberin
6	9606.ENSP00000295897	0.888	Serum albumin
7	9606.ENSP00000303452	0.871	Pro-thyrotropin-releasing hormone
8	9606.ENSP00000302665	0.859	Insulin-like growth factor I
9	9606.ENSP00000462647	0.848	Pituitary adenylate cyclase-activating polypeptide
10	9606.ENSP00000276414	0.845	Progonadoliberin-1
11	9606.ENSP00000176195	0.840	Secretin
12	9606.ENSP00000312673	0.834	Somatotropin
13	9606.ENSP00000384092	0.831	Pro-opiomelanocortin
14	9606.ENSP00000327246	0.810	Vasoactive intestinal polypeptide receptor 1
15	9606.ENSP00000241256	0.801	Growth hormone secretagogue receptor type 1
16	9606.ENSP00000387662	0.795	Glucagon
17	9606.ENSP00000282091	0.794	Parathyroid hormone
18	9606.ENSP00000262178	0.780	Vasoactive intestinal polypeptide receptor 2
19	9606.ENSP00000360141	0.778	Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas
20	9606.ENSP00000312652	0.764	Leptin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005179	1.000	hormone activity
GO:0001664	0.981	G protein-coupled receptor binding
GO:0071855	0.917	neuropeptide receptor binding
GO:0016608	0.710	growth hormone-releasing hormone activity
GO:0031770	0.584	growth hormone-releasing hormone receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0050896	0.990	response to stimulus
GO:0009987	0.987	cellular process
GO:0007188	0.966	adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0007267	0.940	cell-cell signaling
GO:0048522	0.939	positive regulation of cellular process
GO:0010646	0.930	regulation of cell communication
GO:0023051	0.928	regulation of signaling
GO:0051050	0.928	positive regulation of transport
GO:1903532	0.918	positive regulation of secretion by cell
GO:0046883	0.917	regulation of hormone secretion
GO:0046887	0.913	positive regulation of hormone secretion
GO:0007189	0.886	adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0051239	0.879	regulation of multicellular organismal process
GO:0032501	0.869	multicellular organismal process
GO:0002791	0.861	regulation of peptide secretion
GO:0051240	0.784	positive regulation of multicellular organismal process
GO:0032502	0.750	developmental process
GO:0051094	0.747	positive regulation of developmental process
GO:0006810	0.722	transport
GO:0090276	0.686	regulation of peptide hormone secretion
GO:0002793	0.685	positive regulation of peptide secretion
GO:0002790	0.671	peptide secretion
GO:0090277	0.671	positive regulation of peptide hormone secretion
GO:0009914	0.670	hormone transport
GO:0023061	0.649	signal release
GO:0046879	0.633	hormone secretion
GO:0030072	0.516	peptide hormone secretion
GO:0042127	0.415	regulation of cell population proliferation
GO:0048856	0.406	anatomical structure development
GO:0042221	0.386	response to chemical
GO:0048519	0.380	negative regulation of biological process
GO:0019222	0.365	regulation of metabolic process
GO:0040008	0.364	regulation of growth
GO:0060255	0.327	regulation of macromolecule metabolic process
GO:0048638	0.323	regulation of developmental growth

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0005615	0.763	extracellular space
GO:0043226	0.730	organelle
GO:0043227	0.722	membrane-bounded organelle
GO:0005622	0.701	intracellular anatomical structure
GO:0012505	0.386	endomembrane system
GO:0120025	0.363	plasma membrane bounded cell projection
GO:0043229	0.310	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]