StarFunc result for job id P01308

User Input

>input (110 residues)
MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAED
LQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:I3WAC9	0.378	0.378	4.312E-15	110	1.000	1.000	I3WAC9.pdb.gz	I3WAC9_HUMAN Insulin OS=Homo sapiens OX=9606 GN=INS PE=1 SV=1
2	AFDB:P01315	0.460	0.468	3.839E-12	108	0.855	0.870	P01315.pdb.gz	INS_PIG Insulin OS=Sus scrofa OX=9823 GN=INS PE=1 SV=2
3	AFDB:A5PJB2	0.379	0.392	7.209E-12	105	0.782	0.819	A5PJB2.pdb.gz	A5PJB2_BOVIN Insulin OS=Bos taurus OX=9913 GN=INS PE=2 SV=1
4	AFDB:P01322	0.574	0.574	3.137E-11	110	0.827	0.827	P01322.pdb.gz	INS1_RAT Insulin-1 OS=Rattus norvegicus OX=10116 GN=Ins1 PE=1 SV=1
5	AFDB:O73727	0.389	0.392	7.109E-5	108	0.464	0.472	O73727.pdb.gz	INS_DANRE Insulin OS=Danio rerio OX=7955 GN=ins PE=3 SV=1
6	AFDB:Q7TSB7	0.167	0.147	2.588	130	0.182	0.154	Q7TSB7.pdb.gz	KISS1_RAT Metastasis-suppressor KiSS-1 OS=Rattus norvegicus OX=10116 GN=Kiss1 PE=2 SV=1
7	AFDB:A0A0B4KHB5	0.163	0.053	2.977	509	0.136	0.029	A0A0B4KHB5.pdb.gz	A0A0B4KHB5_DROME Trivet, isoform E OS=Drosophila melanogaster OX=7227 GN=trv PE=4 SV=1
8	AFDB:P52020	0.165	0.052	3.673	573	0.155	0.030	P52020.pdb.gz	ERG1_RAT Squalene monooxygenase OS=Rattus norvegicus OX=10116 GN=Sqle PE=1 SV=1
9	AFDB:Q22909	0.153	0.084	5.997	237	0.173	0.080	Q22909.pdb.gz	HM30_CAEEL Homeobox protein ceh-30 OS=Caenorhabditis elegans OX=6239 GN=ceh-30 PE=2 SV=2
10	AFDB:F1RBA7	0.140	0.047	6.432	385	0.100	0.029	F1RBA7.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	I3WAC9	6.71e-77	223	110	1.000	1.000	I3WAC9_HUMAN Insulin OS=Homo sapiens OX=9606 GN=INS PE=1 SV=1
2	P01308	6.71e-77	223	110	1.000	1.000	INS_HUMAN Insulin OS=Homo sapiens OX=9606 GN=INS PE=1 SV=1
3	P01323	1.44e-56	172	110	0.827	0.827	INS2_RAT Insulin-2 OS=Rattus norvegicus OX=10116 GN=Ins2 PE=1 SV=1
4	P01322	4.52e-56	171	110	0.827	0.827	INS1_RAT Insulin-1 OS=Rattus norvegicus OX=10116 GN=Ins1 PE=1 SV=1
5	P01326	2.08e-55	169	110	0.818	0.818	INS2_MOUSE Insulin-2 OS=Mus musculus OX=10090 GN=Ins2 PE=1 SV=1
6	P01325	1.94e-49	154	108	0.782	0.796	INS1_MOUSE Insulin-1 OS=Mus musculus OX=10090 GN=Ins1 PE=1 SV=1
7	P01315	2.39e-40	131	108	0.855	0.870	INS_PIG Insulin OS=Sus scrofa OX=9823 GN=INS PE=1 SV=2
8	P67970	1.13e-39	129	107	0.636	0.654	INS_CHICK Insulin OS=Gallus gallus OX=9031 GN=INS PE=1 SV=1
9	P01317	4.12e-36	120	105	0.764	0.800	INS_BOVIN Insulin OS=Bos taurus OX=9913 GN=INS PE=1 SV=2
10	P01318	1.15e-35	119	105	0.755	0.790	INS_SHEEP Insulin OS=Ovis aries OX=9940 GN=INS PE=1 SV=2
11	A5PJB2	1.78e-35	119	105	0.764	0.800	A5PJB2_BOVIN Insulin OS=Bos taurus OX=9913 GN=INS PE=2 SV=1
12	I7CLV3	4.37e-33	112	81	0.591	0.802	I7CLV3_BOVIN Insulin (Fragment) OS=Bos taurus OX=9913 PE=2 SV=1
13	A3RID7	1.66e-21	83.6	107	0.500	0.514	A3RID7_ONCMY Insulin OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
14	A3RID6	3.34e-21	82.8	105	0.418	0.438	A3RID6_ONCMY Insulin OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
15	O73727	6.00e-20	79.7	108	0.400	0.407	INS_DANRE Insulin OS=Danio rerio OX=7955 GN=ins PE=3 SV=1
16	G8HMZ4	4.54e-09	52.8	153	0.309	0.222	G8HMZ4_CHICK Insulin-like growth factor 1 OS=Gallus gallus OX=9031 GN=IGF-1 PE=3 SV=1
17	G8HMZ3	5.15e-09	52.8	153	0.309	0.222	G8HMZ3_CHICK Insulin-like growth factor 1 OS=Gallus gallus OX=9031 GN=IGF-1 PE=3 SV=1
18	Q2F6J3	8.67e-09	50.8	99	0.309	0.343	Q2F6J3_BOVIN Insulin-like growth factor II (Fragment) OS=Bos taurus OX=9913 GN=IGF2 PE=2 SV=1
19	Q08279	2.05e-08	50.4	128	0.309	0.266	IGF2_CAVPO Insulin-like growth factor II (Fragment) OS=Cavia porcellus OX=10141 GN=IGF2 PE=2 SV=1
20	G8HMZ1	2.36e-08	50.8	153	0.318	0.229	G8HMZ1_CHICK Insulin-like growth factor 1 OS=Gallus gallus OX=9031 GN=IGF-1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00049 Insulin	2.1e-22	91.3	Insulin/IGF/Relaxin family
2	PF03488 Ins_beta	2.3e+02	13.2	Nematode insulin-related peptide beta type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000380432

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265986	0.999	Insulin-degrading enzyme
2	9606.ENSP00000268035	0.999	Insulin-like growth factor 1 receptor
3	9606.ENSP00000303830	0.999	Insulin receptor
4	9606.ENSP00000302665	0.998	Insulin-like growth factor I
5	9606.ENSP00000304895	0.997	Insulin receptor substrate 1
6	9606.ENSP00000240652	0.995	Islet amyloid polypeptide
7	9606.ENSP00000431418	0.994	High affinity nerve growth factor receptor
8	9606.ENSP00000295666	0.991	Insulin-like growth factor-binding protein 7
9	9606.ENSP00000295897	0.990	Serum albumin
10	9606.ENSP00000451828	0.990	RAC-alpha serine/threonine-protein kinase
11	9606.ENSP00000335074	0.988	Appetite-regulating hormone
12	9606.ENSP00000365016	0.983	Insulin receptor substrate 2
13	9606.ENSP00000391826	0.983	Insulin-like growth factor II
14	9606.ENSP00000368880	0.980	Forkhead box protein O1
15	9606.ENSP00000376345	0.980	Growth factor receptor-bound protein 2
16	9606.ENSP00000264867	0.979	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
17	9606.ENSP00000265171	0.979	Pro-epidermal growth factor
18	9606.ENSP00000370421	0.977	Pancreas/duodenum homeobox protein 1
19	9606.ENSP00000225577	0.975	Ribosomal protein S6 kinase beta-1
20	9606.ENSP00000360683	0.974	Tyrosine-protein phosphatase non-receptor type 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	0.999	signaling receptor binding
GO:0044877	0.998	protein-containing complex binding
GO:0005158	0.992	insulin receptor binding
GO:0098772	0.846	molecular function regulator activity
GO:0140677	0.739	molecular function activator activity
GO:0048018	0.676	receptor ligand activity
GO:0005159	0.517	insulin-like growth factor receptor binding
GO:0042802	0.367	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051716	0.987	cellular response to stimulus
GO:0048522	0.987	positive regulation of cellular process
GO:0019222	0.985	regulation of metabolic process
GO:0023052	0.975	signaling
GO:0065008	0.975	regulation of biological quality
GO:0032879	0.975	regulation of localization
GO:0080090	0.975	regulation of primary metabolic process
GO:0032868	0.975	response to insulin
GO:0048519	0.974	negative regulation of biological process
GO:0008643	0.974	carbohydrate transport
GO:0007154	0.972	cell communication
GO:0032869	0.969	cellular response to insulin stimulus
GO:0090277	0.965	positive regulation of peptide hormone secretion
GO:0060255	0.963	regulation of macromolecule metabolic process
GO:0008645	0.963	hexose transmembrane transport
GO:0009893	0.961	positive regulation of metabolic process
GO:0048583	0.957	regulation of response to stimulus
GO:0009894	0.957	regulation of catabolic process
GO:0050708	0.956	regulation of protein secretion
GO:0032501	0.953	multicellular organismal process
GO:0045833	0.949	negative regulation of lipid metabolic process
GO:0010604	0.947	positive regulation of macromolecule metabolic process
GO:0032101	0.946	regulation of response to external stimulus
GO:0009895	0.946	negative regulation of catabolic process
GO:1903829	0.946	positive regulation of protein localization
GO:0006950	0.921	response to stress
GO:0051222	0.921	positive regulation of protein transport
GO:1902533	0.919	positive regulation of intracellular signal transduction
GO:0051239	0.913	regulation of multicellular organismal process
GO:0031323	0.909	regulation of cellular metabolic process
GO:0048523	0.897	negative regulation of cellular process
GO:0051240	0.896	positive regulation of multicellular organismal process
GO:0071704	0.895	organic substance metabolic process
GO:0044238	0.879	primary metabolic process
GO:0042127	0.878	regulation of cell population proliferation
GO:0008284	0.863	positive regulation of cell population proliferation
GO:1904659	0.853	glucose transmembrane transport
GO:0007169	0.846	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0050714	0.842	positive regulation of protein secretion
GO:0050796	0.839	regulation of insulin secretion
GO:0050994	0.828	regulation of lipid catabolic process
GO:0032024	0.828	positive regulation of insulin secretion
GO:0032104	0.823	regulation of response to extracellular stimulus
GO:0048585	0.811	negative regulation of response to stimulus
GO:0050793	0.801	regulation of developmental process
GO:0010468	0.796	regulation of gene expression
GO:0042325	0.780	regulation of phosphorylation
GO:0060548	0.773	negative regulation of cell death
GO:0009605	0.768	response to external stimulus
GO:0051247	0.759	positive regulation of protein metabolic process
GO:0044093	0.757	positive regulation of molecular function
GO:1900076	0.742	regulation of cellular response to insulin stimulus
GO:0031325	0.739	positive regulation of cellular metabolic process
GO:0044237	0.714	cellular metabolic process
GO:0031399	0.714	regulation of protein modification process
GO:0010556	0.709	regulation of macromolecule biosynthetic process
GO:0042981	0.707	regulation of apoptotic process
GO:0031326	0.676	regulation of cellular biosynthetic process
GO:0050790	0.668	regulation of catalytic activity
GO:0019219	0.659	regulation of nucleobase-containing compound metabolic process
GO:0051094	0.658	positive regulation of developmental process
GO:0051048	0.603	negative regulation of secretion
GO:0043069	0.590	negative regulation of programmed cell death
GO:0031324	0.584	negative regulation of cellular metabolic process
GO:0043066	0.579	negative regulation of apoptotic process
GO:1900078	0.573	positive regulation of cellular response to insulin stimulus
GO:0031328	0.562	positive regulation of cellular biosynthetic process
GO:0045935	0.557	positive regulation of nucleobase-containing compound metabolic process
GO:0051241	0.551	negative regulation of multicellular organismal process
GO:0051641	0.528	cellular localization
GO:0010605	0.517	negative regulation of macromolecule metabolic process
GO:0009628	0.492	response to abiotic stimulus
GO:0033500	0.490	carbohydrate homeostasis
GO:0042593	0.479	glucose homeostasis
GO:0006807	0.465	nitrogen compound metabolic process
GO:0046628	0.451	positive regulation of insulin receptor signaling pathway
GO:0003008	0.438	system process
GO:0031667	0.413	response to nutrient levels
GO:0062012	0.376	regulation of small molecule metabolic process
GO:0032502	0.373	developmental process
GO:2000026	0.369	regulation of multicellular organismal development
GO:0062013	0.369	positive regulation of small molecule metabolic process
GO:0048856	0.346	anatomical structure development
GO:1901564	0.310	organonitrogen compound metabolic process
GO:0007610	0.302	behavior

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0012505	0.993	endomembrane system
GO:0043231	0.972	intracellular membrane-bounded organelle
GO:0005737	0.961	cytoplasm
GO:0031982	0.847	vesicle
GO:0070013	0.832	intracellular organelle lumen
GO:0016020	0.831	membrane
GO:0031410	0.649	cytoplasmic vesicle
GO:0030141	0.455	secretory granule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]