StarFunc result for job id P01374

User Input

>input (205 residues)
MTPPERLFLPRVCGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHST
LKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAY
SPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQ
LSTHTDGIPHLVLSPSTVFFGAFAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P01374	1.000	1.000	6.741E-38	205	1.000	1.000	P01374.pdb.gz	TNFB_HUMAN Lymphotoxin-alpha OS=Homo sapiens OX=9606 GN=LTA PE=1 SV=2
2	AFDB:P09225	0.691	0.701	2.280E-26	202	0.722	0.733	P09225.pdb.gz	TNFB_MOUSE Lymphotoxin-alpha OS=Mus musculus OX=10090 GN=Lta PE=2 SV=1
3	AFDB:Q1JQ40	0.662	0.564	1.481E-16	242	0.312	0.264	Q1JQ40.pdb.gz
4	AFDB:P06804	0.663	0.581	2.966E-16	235	0.312	0.272	P06804.pdb.gz	TNFA_MOUSE Tumor necrosis factor OS=Mus musculus OX=10090 GN=Tnf PE=1 SV=2
5	AFDB:B3GDZ6	0.647	0.573	1.013E-15	232	0.283	0.250	B3GDZ6.pdb.gz	B3GDZ6_PIG Tumor necrosis factor OS=Sus scrofa OX=9823 GN=TNFa PE=2 SV=1
6	AFDB:Q08CQ3	0.648	0.573	8.137E-15	234	0.298	0.261	Q08CQ3.pdb.gz	Q08CQ3_DANRE Lymphotoxin-alpha OS=Danio rerio OX=7955 GN=tnfa PE=2 SV=1
7	AFDB:Q06599	0.655	0.576	1.316E-14	234	0.278	0.244	Q06599.pdb.gz	TNFA_BOVIN Tumor necrosis factor OS=Bos taurus OX=9913 GN=TNF PE=2 SV=2
8	AFDB:P01375	0.643	0.568	1.913E-14	233	0.298	0.262	P01375.pdb.gz	TNFA_HUMAN Tumor necrosis factor OS=Homo sapiens OX=9606 GN=TNF PE=1 SV=1
9	AFDB:Q8K3Y7	0.630	0.516	2.780E-14	252	0.307	0.250	Q8K3Y7.pdb.gz	TNF15_RAT Tumor necrosis factor ligand superfamily member 15 OS=Rattus norvegicus OX=10116 GN=Tnfsf15 PE=2 SV=1
10	AFDB:Q9DEP9	0.635	0.515	2.780E-14	255	0.283	0.227	Q9DEP9.pdb.gz	Q9DEP9_ONCMY Tumor necrosis factor OS=Oncorhynchus mykiss OX=8022 GN=tnf PE=2 SV=1
11	PDB:5h4bA	0.434	0.624	7.119E-6	136	0.112	0.169	5h4bA.pdb.gz
12	PDB:5kc6B	0.441	0.599	3.535E-5	144	0.112	0.160	5kc6B.pdb.gz
13	PDB:7e57B	0.389	0.593	5.137E-5	123	0.107	0.179	7e57B.pdb.gz	Atypical TNF-TNFR superfamily binding interface in the GITR-GITRL complex for T cell activation.
14	PDB:7drtB	0.227	0.118	2.960E-2	496	0.068	0.028	7drtB.pdb.gz	Cryo-EM structure of human Wntless in complex with Wnt3a.
15	PDB:6xwuA	0.160	0.220	3.122E-2	138	0.078	0.116	6xwuA.pdb.gz
16	PDB:4tlgA	0.203	0.119	4.078E-2	396	0.059	0.030	4tlgA.pdb.gz	Crystal structure of SEC14-like protein 4 (SEC14L4)
17	PDB:5ntuA	0.278	0.208	5.927E-2	308	0.059	0.039	5ntuA.pdb.gz
18	PDB:3cl5A	0.253	0.178	6.957E-2	358	0.093	0.053	3cl5A.pdb.gz	Structure of coronavirus hemagglutinin-esterase offers insight into corona and influenza virus evolution.
19	PDB:6ds5A	0.264	0.319	7.339E-2	160	0.093	0.119	6ds5A.pdb.gz
20	PDB:7l2zF	0.203	0.082	8.614E-2	664	0.098	0.030	7l2zF.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P01374	1.62e-147	410	205	1.000	1.000	TNFB_HUMAN Lymphotoxin-alpha OS=Homo sapiens OX=9606 GN=LTA PE=1 SV=2
2	Q6FG55	1.05e-145	405	205	0.995	0.995	Q6FG55_HUMAN Lymphotoxin-alpha OS=Homo sapiens OX=9606 GN=LTA PE=1 SV=1
3	Q06332	3.77e-89	262	202	0.727	0.738	TNFB_RAT Lymphotoxin-alpha OS=Rattus norvegicus OX=10116 GN=Lta PE=3 SV=1
4	P09225	2.97e-87	257	202	0.634	0.644	TNFB_MOUSE Lymphotoxin-alpha OS=Mus musculus OX=10090 GN=Lta PE=2 SV=1
5	Q4W898	4.11e-24	97.4	242	0.312	0.264	Q4W898_DANRE Lymphotoxin-alpha OS=Danio rerio OX=7955 GN=tnf PE=2 SV=1
6	Q08CQ3	7.88e-22	91.3	234	0.273	0.239	Q08CQ3_DANRE Lymphotoxin-alpha OS=Danio rerio OX=7955 GN=tnfa PE=2 SV=1
7	Q1L8A5	8.05e-22	91.3	234	0.273	0.239	Q1L8A5_DANRE Lymphotoxin-alpha OS=Danio rerio OX=7955 GN=tnfa PE=1 SV=1
8	Q9I970	5.11e-21	89.4	246	0.259	0.215	Q9I970_ONCMY Tumor necrosis factor alpha OS=Oncorhynchus mykiss OX=8022 GN=tnfa PE=3 SV=1
9	Q9I976	5.39e-21	89.4	246	0.259	0.215	Q9I976_ONCMY Putative tumour necrosis factor alpha OS=Oncorhynchus mykiss OX=8022 GN=TNF-alpha PE=2 SV=1
10	P16599	5.95e-21	89.0	235	0.332	0.289	TNFA_RAT Tumor necrosis factor OS=Rattus norvegicus OX=10116 GN=Tnf PE=2 SV=1
11	P06804	6.07e-21	89.0	235	0.337	0.294	TNFA_MOUSE Tumor necrosis factor OS=Mus musculus OX=10090 GN=Tnf PE=1 SV=2
12	Q06599	1.06e-20	88.2	234	0.259	0.226	TNFA_BOVIN Tumor necrosis factor OS=Bos taurus OX=9913 GN=TNF PE=2 SV=2
13	P01375	1.10e-20	88.2	233	0.249	0.219	TNFA_HUMAN Tumor necrosis factor OS=Homo sapiens OX=9606 GN=TNF PE=1 SV=1
14	C1K3N5	1.23e-20	88.2	232	0.249	0.220	C1K3N5_HUMAN Tumor necrosis factor (Fragment) OS=Homo sapiens OX=9606 GN=TNF PE=2 SV=1
15	B3GDZ6	5.15e-20	86.3	232	0.244	0.216	B3GDZ6_PIG Tumor necrosis factor OS=Sus scrofa OX=9823 GN=TNFa PE=2 SV=1
16	P23563	5.15e-20	86.3	232	0.244	0.216	TNFA_PIG Tumor necrosis factor OS=Sus scrofa OX=9823 GN=TNF PE=2 SV=1
17	Q9DEP9	2.58e-19	85.1	255	0.254	0.204	Q9DEP9_ONCMY Tumor necrosis factor OS=Oncorhynchus mykiss OX=8022 GN=tnf PE=2 SV=1
18	P36940	3.84e-15	73.9	278	0.234	0.173	TNFL6_RAT Tumor necrosis factor ligand superfamily member 6 OS=Rattus norvegicus OX=10116 GN=Faslg PE=2 SV=1
19	P41047	4.84e-15	73.9	279	0.215	0.158	TNFL6_MOUSE Tumor necrosis factor ligand superfamily member 6 OS=Mus musculus OX=10090 GN=Faslg PE=1 SV=1
20	Q8K3Y7	7.49e-15	72.8	252	0.293	0.238	TNF15_RAT Tumor necrosis factor ligand superfamily member 15 OS=Rattus norvegicus OX=10116 GN=Tnfsf15 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00229 TNF	1.6e-29	113.9	TNF(Tumour Necrosis Factor) family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000403495

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000162749	0.999	Tumor necrosis factor receptor superfamily member 1A
2	9606.ENSP00000365435	0.997	Tumor necrosis factor receptor superfamily member 1B
3	9606.ENSP00000347948	0.996	Tumor necrosis factor receptor superfamily member 14
4	9606.ENSP00000410481	0.994	Lymphotoxin-beta
5	9606.ENSP00000228918	0.992	Tumor necrosis factor receptor superfamily member 3
6	9606.ENSP00000259808	0.963	Receptor-interacting serine/threonine-protein kinase 1
7	9606.ENSP00000362994	0.939	TNF receptor-associated factor 1
8	9606.ENSP00000482657	0.935	Mitogen-activated protein kinase kinase kinase 14
9	9606.ENSP00000263341	0.925	Interleukin-1 beta
10	9606.ENSP00000247668	0.922	TNF receptor-associated factor 2
11	9606.ENSP00000454207	0.922	TNF receptor-associated factor 3
12	9606.ENSP00000412237	0.913	Interleukin-10
13	9606.ENSP00000398698	0.908	Tumor necrosis factor
14	9606.ENSP00000376505	0.905	TRAF family member-associated NF-kappa-B activator
15	9606.ENSP00000382423	0.904	Mitogen-activated protein kinase kinase kinase 1
16	9606.ENSP00000361359	0.873	Tumor necrosis factor receptor superfamily member 5
17	9606.ENSP00000385675	0.839	Interleukin-6
18	9606.ENSP00000359663	0.833	CD40 ligand
19	9606.ENSP00000381775	0.818	Tumor necrosis factor ligand superfamily member 11
20	9606.ENSP00000226730	0.817	Interleukin-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0005126	0.918	cytokine receptor binding
GO:0032813	0.682	tumor necrosis factor receptor superfamily binding
GO:0098772	0.640	molecular function regulator activity
GO:0140677	0.580	molecular function activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.999	response to stimulus
GO:0050789	0.995	regulation of biological process
GO:0050794	0.992	regulation of cellular process
GO:0009987	0.985	cellular process
GO:0048518	0.975	positive regulation of biological process
GO:0051716	0.952	cellular response to stimulus
GO:0007154	0.947	cell communication
GO:0023052	0.937	signaling
GO:0048522	0.919	positive regulation of cellular process
GO:0007165	0.852	signal transduction
GO:0048583	0.805	regulation of response to stimulus
GO:0008219	0.797	cell death
GO:0019222	0.737	regulation of metabolic process
GO:0060255	0.654	regulation of macromolecule metabolic process
GO:0048584	0.623	positive regulation of response to stimulus
GO:0002376	0.606	immune system process
GO:0010604	0.590	positive regulation of macromolecule metabolic process
GO:0006955	0.571	immune response
GO:0051239	0.567	regulation of multicellular organismal process
GO:0010468	0.522	regulation of gene expression
GO:0032501	0.514	multicellular organismal process
GO:0042221	0.509	response to chemical
GO:0009605	0.495	response to external stimulus
GO:0006950	0.480	response to stress
GO:0048519	0.479	negative regulation of biological process
GO:0051171	0.467	regulation of nitrogen compound metabolic process
GO:0002684	0.457	positive regulation of immune system process
GO:0006915	0.452	apoptotic process
GO:0042127	0.450	regulation of cell population proliferation
GO:0051240	0.433	positive regulation of multicellular organismal process
GO:0080090	0.430	regulation of primary metabolic process
GO:0006952	0.422	defense response
GO:0044419	0.418	biological process involved in interspecies interaction between organisms
GO:0032101	0.409	regulation of response to external stimulus
GO:0080134	0.406	regulation of response to stress
GO:0001817	0.396	regulation of cytokine production
GO:0009607	0.388	response to biotic stimulus
GO:0048856	0.386	anatomical structure development
GO:0010033	0.362	response to organic substance
GO:0007267	0.352	cell-cell signaling
GO:0031323	0.346	regulation of cellular metabolic process
GO:0048523	0.345	negative regulation of cellular process
GO:0010628	0.333	positive regulation of gene expression
GO:0008284	0.329	positive regulation of cell population proliferation
GO:0010941	0.327	regulation of cell death
GO:0051707	0.324	response to other organism
GO:0001819	0.322	positive regulation of cytokine production
GO:0009966	0.310	regulation of signal transduction
GO:0042981	0.309	regulation of apoptotic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0005576	0.928	extracellular region
GO:0005615	0.765	extracellular space
GO:0005622	0.712	intracellular anatomical structure
GO:0005737	0.617	cytoplasm
GO:0043231	0.579	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]