StarFunc result for job id P01375

User Input

>input (233 residues)
MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR
EEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR
DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE
TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P01375	1.000	1.000	1.507E-42	233	1.000	1.000	P01375.pdb.gz	TNFA_HUMAN Tumor necrosis factor OS=Homo sapiens OX=9606 GN=TNF PE=1 SV=1
2	AFDB:B3GDZ6	0.773	0.776	1.750E-35	232	0.867	0.871	B3GDZ6.pdb.gz	B3GDZ6_PIG Tumor necrosis factor OS=Sus scrofa OX=9823 GN=TNFa PE=2 SV=1
3	AFDB:Q06599	0.764	0.761	7.165E-35	234	0.803	0.799	Q06599.pdb.gz	TNFA_BOVIN Tumor necrosis factor OS=Bos taurus OX=9913 GN=TNF PE=2 SV=2
4	AFDB:P06804	0.640	0.635	1.106E-34	235	0.798	0.791	P06804.pdb.gz	TNFA_MOUSE Tumor necrosis factor OS=Mus musculus OX=10090 GN=Tnf PE=1 SV=2
5	AFDB:Q9DEP9	0.568	0.522	2.196E-16	255	0.275	0.251	Q9DEP9.pdb.gz	Q9DEP9_ONCMY Tumor necrosis factor OS=Oncorhynchus mykiss OX=8022 GN=tnf PE=2 SV=1
6	AFDB:Q08CQ3	0.553	0.551	3.987E-16	234	0.253	0.252	Q08CQ3.pdb.gz	Q08CQ3_DANRE Lymphotoxin-alpha OS=Danio rerio OX=7955 GN=tnfa PE=2 SV=1
7	AFDB:Q1JQ40	0.577	0.556	1.633E-15	242	0.245	0.236	Q1JQ40.pdb.gz
8	AFDB:O43557	0.567	0.552	3.683E-15	240	0.240	0.233	O43557.pdb.gz	TNF14_HUMAN Tumor necrosis factor ligand superfamily member 14 OS=Homo sapiens OX=9606 GN=TNFSF14 PE=1 SV=2
9	AFDB:P48023	0.566	0.474	3.683E-15	281	0.227	0.189	P48023.pdb.gz	TNFL6_HUMAN Tumor necrosis factor ligand superfamily member 6 OS=Homo sapiens OX=9606 GN=FASLG PE=1 SV=1
10	AFDB:P01374	0.568	0.643	6.687E-15	205	0.253	0.288	P01374.pdb.gz	TNFB_HUMAN Lymphotoxin-alpha OS=Homo sapiens OX=9606 GN=LTA PE=1 SV=2
11	PDB:7e57B	0.364	0.634	4.583E-5	123	0.120	0.228	7e57B.pdb.gz	Atypical TNF-TNFR superfamily binding interface in the GITR-GITRL complex for T cell activation.
12	PDB:5kc6B	0.380	0.575	5.693E-5	144	0.082	0.132	5kc6B.pdb.gz
13	PDB:5h4bA	0.385	0.623	1.511E-4	136	0.086	0.147	5h4bA.pdb.gz
14	PDB:7drtB	0.219	0.129	4.128E-3	496	0.086	0.040	7drtB.pdb.gz	Cryo-EM structure of human Wntless in complex with Wnt3a.
15	PDB:5nxsA	0.224	0.193	6.034E-3	290	0.090	0.072	5nxsA.pdb.gz
16	PDB:5vqfB	0.191	0.154	7.100E-3	320	0.090	0.066	5vqfB.pdb.gz
17	PDB:3i26D	0.180	0.135	7.495E-3	369	0.090	0.057	3i26D.pdb.gz	Structural basis for ligand and substrate recognition by torovirus hemagglutinin esterases
18	PDB:5ffoG	0.234	0.197	9.830E-3	297	0.137	0.108	5ffoG.pdb.gz	Force interacts with macromolecular structure in activation of TGF-beta.
19	PDB:5hlyA	0.253	0.213	1.096E-2	299	0.064	0.050	5hlyA.pdb.gz
20	PDB:6ds5A	0.266	0.348	1.601E-2	160	0.064	0.094	6ds5A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P01375	1.24e-173	478	233	1.000	1.000	TNFA_HUMAN Tumor necrosis factor OS=Homo sapiens OX=9606 GN=TNF PE=1 SV=1
2	C1K3N5	1.12e-172	476	232	0.996	1.000	C1K3N5_HUMAN Tumor necrosis factor (Fragment) OS=Homo sapiens OX=9606 GN=TNF PE=2 SV=1
3	B3GDZ6	6.21e-137	385	232	0.867	0.871	B3GDZ6_PIG Tumor necrosis factor OS=Sus scrofa OX=9823 GN=TNFa PE=2 SV=1
4	P23563	6.21e-137	385	232	0.867	0.871	TNFA_PIG Tumor necrosis factor OS=Sus scrofa OX=9823 GN=TNF PE=2 SV=1
5	P06804	1.68e-125	357	235	0.798	0.791	TNFA_MOUSE Tumor necrosis factor OS=Mus musculus OX=10090 GN=Tnf PE=1 SV=2
6	Q06599	2.30e-125	356	234	0.803	0.799	TNFA_BOVIN Tumor necrosis factor OS=Bos taurus OX=9913 GN=TNF PE=2 SV=2
7	P16599	1.56e-123	352	235	0.794	0.787	TNFA_RAT Tumor necrosis factor OS=Rattus norvegicus OX=10116 GN=Tnf PE=2 SV=1
8	Q06332	5.52e-24	97.1	202	0.240	0.277	TNFB_RAT Lymphotoxin-alpha OS=Rattus norvegicus OX=10116 GN=Lta PE=3 SV=1
9	P09225	6.20e-24	96.7	202	0.240	0.277	TNFB_MOUSE Lymphotoxin-alpha OS=Mus musculus OX=10090 GN=Lta PE=2 SV=1
10	Q8K3Y7	2.60e-23	96.3	252	0.313	0.290	TNF15_RAT Tumor necrosis factor ligand superfamily member 15 OS=Rattus norvegicus OX=10116 GN=Tnfsf15 PE=2 SV=1
11	Q9I970	2.47e-22	93.6	246	0.227	0.215	Q9I970_ONCMY Tumor necrosis factor alpha OS=Oncorhynchus mykiss OX=8022 GN=tnfa PE=3 SV=1
12	Q9I976	4.20e-22	93.2	246	0.219	0.207	Q9I976_ONCMY Putative tumour necrosis factor alpha OS=Oncorhynchus mykiss OX=8022 GN=TNF-alpha PE=2 SV=1
13	P01374	1.41e-20	88.2	205	0.219	0.249	TNFB_HUMAN Lymphotoxin-alpha OS=Homo sapiens OX=9606 GN=LTA PE=1 SV=2
14	Q6FG55	1.47e-20	87.8	205	0.219	0.249	Q6FG55_HUMAN Lymphotoxin-alpha OS=Homo sapiens OX=9606 GN=LTA PE=1 SV=1
15	Q9DEP9	2.80e-20	88.2	255	0.215	0.196	Q9DEP9_ONCMY Tumor necrosis factor OS=Oncorhynchus mykiss OX=8022 GN=tnf PE=2 SV=1
16	Q08CQ3	6.57e-20	87.0	234	0.296	0.295	Q08CQ3_DANRE Lymphotoxin-alpha OS=Danio rerio OX=7955 GN=tnfa PE=2 SV=1
17	Q1L8A5	7.07e-20	86.7	234	0.300	0.299	Q1L8A5_DANRE Lymphotoxin-alpha OS=Danio rerio OX=7955 GN=tnfa PE=1 SV=1
18	O95150	2.60e-18	82.8	251	0.223	0.207	TNF15_HUMAN Tumor necrosis factor ligand superfamily member 15 OS=Homo sapiens OX=9606 GN=TNFSF15 PE=1 SV=2
19	Q4W898	4.36e-15	73.9	242	0.206	0.198	Q4W898_DANRE Lymphotoxin-alpha OS=Danio rerio OX=7955 GN=tnf PE=2 SV=1
20	P36940	1.20e-13	70.5	278	0.253	0.212	TNFL6_RAT Tumor necrosis factor ligand superfamily member 6 OS=Rattus norvegicus OX=10116 GN=Faslg PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00229 TNF	2.9e-37	138.9	TNF(Tumour Necrosis Factor) family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000398698

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000162749	0.999	Tumor necrosis factor receptor superfamily member 1A
2	9606.ENSP00000341268	0.999	Tumor necrosis factor receptor type 1-associated DEATH domain protein
3	9606.ENSP00000365435	0.999	Tumor necrosis factor receptor superfamily member 1B
4	9606.ENSP00000247668	0.998	TNF receptor-associated factor 2
5	9606.ENSP00000259808	0.998	Receptor-interacting serine/threonine-protein kinase 1
6	9606.ENSP00000483825	0.998	NF-kappa-B essential modulator
7	9606.ENSP00000477613	0.997	Baculoviral IAP repeat-containing protein 2
8	9606.ENSP00000301838	0.996	FAS-associated death domain protein
9	9606.ENSP00000412237	0.996	Interleukin-10
10	9606.ENSP00000481570	0.996	Tumor necrosis factor alpha-induced protein 3
11	9606.ENSP00000385675	0.994	Interleukin-6
12	9606.ENSP00000231449	0.993	Interleukin-4
13	9606.ENSP00000430684	0.993	Inhibitor of nuclear factor kappa-B kinase subunit beta
14	9606.ENSP00000477908	0.993	C-C motif chemokine 3
15	9606.ENSP00000216797	0.992	NF-kappa-B inhibitor alpha
16	9606.ENSP00000225831	0.992	C-C motif chemokine 2
17	9606.ENSP00000306512	0.992	Interleukin-8
18	9606.ENSP00000359424	0.992	Inhibitor of nuclear factor kappa-B kinase subunit alpha
19	9606.ENSP00000482259	0.992	C-C motif chemokine 4
20	9606.ENSP00000376505	0.991	TRAF family member-associated NF-kappa-B activator

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0002020	1.000	protease binding
GO:0005164	1.000	tumor necrosis factor receptor binding
GO:0005125	1.000	cytokine activity
GO:0042802	0.856	identical protein binding
GO:0097159	0.793	organic cyclic compound binding
GO:1901363	0.764	heterocyclic compound binding
GO:0003676	0.665	nucleic acid binding
GO:0003677	0.591	DNA binding
GO:0003690	0.566	double-stranded DNA binding
GO:0043565	0.543	sequence-specific DNA binding
GO:0001067	0.535	transcription regulatory region nucleic acid binding
GO:1990837	0.502	sequence-specific double-stranded DNA binding
GO:0000976	0.473	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0050896	0.987	response to stimulus
GO:0009987	0.987	cellular process
GO:0048522	0.986	positive regulation of cellular process
GO:0023051	0.979	regulation of signaling
GO:0010646	0.979	regulation of cell communication
GO:0060255	0.976	regulation of macromolecule metabolic process
GO:0023056	0.949	positive regulation of signaling
GO:0010647	0.949	positive regulation of cell communication
GO:1904035	0.947	regulation of epithelial cell apoptotic process
GO:0080090	0.946	regulation of primary metabolic process
GO:0051171	0.945	regulation of nitrogen compound metabolic process
GO:0010468	0.933	regulation of gene expression
GO:0007154	0.931	cell communication
GO:0009893	0.931	positive regulation of metabolic process
GO:0051239	0.919	regulation of multicellular organismal process
GO:0010942	0.918	positive regulation of cell death
GO:0010604	0.913	positive regulation of macromolecule metabolic process
GO:0023052	0.909	signaling
GO:0051246	0.900	regulation of protein metabolic process
GO:0051716	0.896	cellular response to stimulus
GO:0032103	0.893	positive regulation of response to external stimulus
GO:0051247	0.887	positive regulation of protein metabolic process
GO:0006950	0.884	response to stress
GO:0043068	0.879	positive regulation of programmed cell death
GO:0031323	0.873	regulation of cellular metabolic process
GO:0048519	0.861	negative regulation of biological process
GO:0051240	0.852	positive regulation of multicellular organismal process
GO:0010628	0.847	positive regulation of gene expression
GO:0031347	0.843	regulation of defense response
GO:2000351	0.832	regulation of endothelial cell apoptotic process
GO:0006952	0.829	defense response
GO:0043085	0.806	positive regulation of catalytic activity
GO:0031325	0.804	positive regulation of cellular metabolic process
GO:0048523	0.789	negative regulation of cellular process
GO:0006954	0.770	inflammatory response
GO:0031349	0.762	positive regulation of defense response
GO:0050727	0.750	regulation of inflammatory response
GO:0032879	0.748	regulation of localization
GO:0043065	0.741	positive regulation of apoptotic process
GO:0051046	0.740	regulation of secretion
GO:0007165	0.738	signal transduction
GO:0050793	0.736	regulation of developmental process
GO:0065008	0.734	regulation of biological quality
GO:0051336	0.734	regulation of hydrolase activity
GO:0050729	0.734	positive regulation of inflammatory response
GO:0051345	0.712	positive regulation of hydrolase activity
GO:0051179	0.702	localization
GO:0030162	0.696	regulation of proteolysis
GO:2001056	0.691	positive regulation of cysteine-type endopeptidase activity
GO:0009966	0.690	regulation of signal transduction
GO:0032501	0.672	multicellular organismal process
GO:0045595	0.614	regulation of cell differentiation
GO:0042221	0.599	response to chemical
GO:1904037	0.547	positive regulation of epithelial cell apoptotic process
GO:0007166	0.533	cell surface receptor signaling pathway
GO:0051668	0.528	localization within membrane
GO:0042127	0.523	regulation of cell population proliferation
GO:0009967	0.517	positive regulation of signal transduction
GO:1902531	0.514	regulation of intracellular signal transduction
GO:0043281	0.498	regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0002376	0.497	immune system process
GO:0008104	0.495	protein localization
GO:0010033	0.489	response to organic substance
GO:0070887	0.488	cellular response to chemical stimulus
GO:0001817	0.487	regulation of cytokine production
GO:1902533	0.487	positive regulation of intracellular signal transduction
GO:0031326	0.476	regulation of cellular biosynthetic process
GO:0072657	0.463	protein localization to membrane
GO:0071310	0.462	cellular response to organic substance
GO:0009892	0.454	negative regulation of metabolic process
GO:0019220	0.451	regulation of phosphate metabolic process
GO:1990778	0.445	protein localization to cell periphery
GO:0072659	0.423	protein localization to plasma membrane
GO:2000026	0.417	regulation of multicellular organismal development
GO:0043280	0.376	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0002682	0.375	regulation of immune system process
GO:0019219	0.357	regulation of nucleobase-containing compound metabolic process
GO:0001819	0.353	positive regulation of cytokine production
GO:0048856	0.341	anatomical structure development
GO:0009605	0.338	response to external stimulus
GO:0051252	0.337	regulation of RNA metabolic process
GO:0002684	0.330	positive regulation of immune system process
GO:0010556	0.327	regulation of macromolecule biosynthetic process
GO:0008284	0.303	positive regulation of cell population proliferation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0005886	0.997	plasma membrane
GO:0032991	0.963	protein-containing complex
GO:0005622	0.869	intracellular anatomical structure
GO:0005737	0.853	cytoplasm
GO:0043227	0.823	membrane-bounded organelle
GO:0043231	0.725	intracellular membrane-bounded organelle
GO:0009986	0.694	cell surface
GO:0098857	0.315	membrane microdomain

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]