StarFunc result for job id P01574

User Input

>input (187 residues)
MTNKCLLQIALLLCFSTTALSMSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFD
IPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLK
TVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINR
LTGYLRN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P01574	1.000	1.000	1.157E-27	187	1.000	1.000	P01574.pdb.gz	IFNB_HUMAN Interferon beta OS=Homo sapiens OX=9606 GN=IFNB1 PE=1 SV=1
2	PDB:1au1A	0.824	0.925	8.476E-21	166	0.877	0.988	1au1A.pdb.gz	The crystal structure of human interferon beta at 2.2-A resolution.
3	AFDB:P70499	0.866	0.879	4.602E-14	184	0.487	0.495	P70499.pdb.gz	IFNB_RAT Interferon beta OS=Rattus norvegicus OX=10116 GN=Ifnb1 PE=1 SV=1
4	AFDB:P01575	0.857	0.879	6.309E-13	182	0.497	0.511	P01575.pdb.gz	IFNB_MOUSE Interferon beta OS=Mus musculus OX=10090 GN=Ifnb1 PE=1 SV=1
5	PDB:1wu3I	0.775	0.893	7.066E-11	161	0.412	0.478	1wu3I.pdb.gz
6	AFDB:P01563	0.733	0.729	6.452E-10	188	0.321	0.319	P01563.pdb.gz	IFNA2_HUMAN Interferon alpha-2 OS=Homo sapiens OX=9606 GN=IFNA2 PE=1 SV=2
7	AFDB:P01570	0.757	0.750	1.135E-9	189	0.321	0.317	P01570.pdb.gz	IFN14_HUMAN Interferon alpha-14 OS=Homo sapiens OX=9606 GN=IFNA14 PE=1 SV=3
8	AFDB:P01566	0.747	0.740	1.195E-9	189	0.310	0.307	P01566.pdb.gz	IFN10_HUMAN Interferon alpha-10 OS=Homo sapiens OX=9606 GN=IFNA10 PE=1 SV=1
9	AFDB:P32881	0.737	0.731	1.258E-9	189	0.299	0.296	P32881.pdb.gz	IFNA8_HUMAN Interferon alpha-8 OS=Homo sapiens OX=9606 GN=IFNA8 PE=1 SV=1
10	AFDB:P01569	0.763	0.756	1.324E-9	189	0.316	0.312	P01569.pdb.gz	IFNA5_HUMAN Interferon alpha-5 OS=Homo sapiens OX=9606 GN=IFNA5 PE=1 SV=1
11	AFDB:P05015	0.780	0.772	1.801E-9	189	0.316	0.312	P05015.pdb.gz	IFN16_HUMAN Interferon alpha-16 OS=Homo sapiens OX=9606 GN=IFNA16 PE=1 SV=1
12	AFDB:P01562	0.721	0.714	3.010E-9	189	0.310	0.307	P01562.pdb.gz	IFNA1_HUMAN Interferon alpha-1/13 OS=Homo sapiens OX=9606 GN=IFNA1 PE=1 SV=1
13	PDB:1itfA	0.677	0.760	2.745E-7	165	0.289	0.327	1itfA.pdb.gz
14	PDB:3se4B	0.586	0.749	2.890E-7	143	0.251	0.329	3se4B.pdb.gz
15	PDB:3ux9A	0.587	0.814	1.348E-6	132	0.230	0.326	3ux9A.pdb.gz
16	PDB:1rh2D	0.592	0.827	2.912E-6	131	0.246	0.351	1rh2D.pdb.gz
17	PDB:6jhdA	0.608	0.674	1.848E-5	166	0.257	0.289	6jhdA.pdb.gz
18	PDB:3pivB	0.638	0.752	3.992E-5	157	0.155	0.185	3pivB.pdb.gz
19	PDB:3piwA	0.635	0.757	8.190E-5	154	0.203	0.247	3piwA.pdb.gz
20	PDB:4cniC	0.310	0.331	1.473E-1	171	0.112	0.123	4cniC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P01574	3.25e-138	385	187	1.000	1.000	IFNB_HUMAN Interferon beta OS=Homo sapiens OX=9606 GN=IFNB1 PE=1 SV=1
2	P70499	5.62e-49	159	184	0.492	0.500	IFNB_RAT Interferon beta OS=Rattus norvegicus OX=10116 GN=Ifnb1 PE=1 SV=1
3	P01575	2.15e-48	157	182	0.492	0.505	IFNB_MOUSE Interferon beta OS=Mus musculus OX=10090 GN=Ifnb1 PE=1 SV=1
4	P05015	2.82e-28	106	189	0.294	0.291	IFN16_HUMAN Interferon alpha-16 OS=Homo sapiens OX=9606 GN=IFNA16 PE=1 SV=1
5	R9XMN7	1.74e-27	103	187	0.337	0.337	R9XMN7_CANLF Interferon 1EA OS=Canis lupus familiaris OX=9615 GN=IF1EA PE=2 SV=1
6	P01569	3.91e-27	103	189	0.283	0.280	IFNA5_HUMAN Interferon alpha-5 OS=Homo sapiens OX=9606 GN=IFNA5 PE=1 SV=1
7	P05000	5.63e-27	103	195	0.262	0.251	IFNW1_HUMAN Interferon omega-1 OS=Homo sapiens OX=9606 GN=IFNW1 PE=1 SV=2
8	P01563	1.81e-26	101	188	0.299	0.298	IFNA2_HUMAN Interferon alpha-2 OS=Homo sapiens OX=9606 GN=IFNA2 PE=1 SV=2
9	P01570	1.95e-26	101	189	0.273	0.270	IFN14_HUMAN Interferon alpha-14 OS=Homo sapiens OX=9606 GN=IFNA14 PE=1 SV=3
10	P05014	2.13e-26	101	189	0.294	0.291	IFNA4_HUMAN Interferon alpha-4 OS=Homo sapiens OX=9606 GN=IFNA4 PE=1 SV=2
11	P01571	4.41e-26	100	189	0.289	0.286	IFN17_HUMAN Interferon alpha-17 OS=Homo sapiens OX=9606 GN=IFNA17 PE=1 SV=2
12	P01567	1.03e-25	99.8	189	0.321	0.317	IFNA7_HUMAN Interferon alpha-7 OS=Homo sapiens OX=9606 GN=IFNA7 PE=1 SV=1
13	P01566	2.96e-25	98.6	189	0.289	0.286	IFN10_HUMAN Interferon alpha-10 OS=Homo sapiens OX=9606 GN=IFNA10 PE=1 SV=1
14	P01562	9.54e-24	94.4	189	0.262	0.259	IFNA1_HUMAN Interferon alpha-1/13 OS=Homo sapiens OX=9606 GN=IFNA1 PE=1 SV=1
15	P01568	9.85e-24	94.4	189	0.273	0.270	IFN21_HUMAN Interferon alpha-21 OS=Homo sapiens OX=9606 GN=IFNA21 PE=1 SV=2
16	P01572	1.39e-23	94.0	189	0.241	0.238	IFNA1_MOUSE Interferon alpha-1 OS=Mus musculus OX=10090 GN=Ifna1 PE=1 SV=2
17	P05013	5.84e-23	92.4	189	0.283	0.280	IFNA6_HUMAN Interferon alpha-6 OS=Homo sapiens OX=9606 GN=IFNA6 PE=1 SV=1
18	A0A7R8C3L7	6.50e-23	92.4	189	0.241	0.238	A0A7R8C3L7_RAT Interferon 1ai3 OS=Rattus norvegicus OX=10116 GN=Ifna1 PE=3 SV=1
19	P32881	3.21e-22	90.5	189	0.262	0.259	IFNA8_HUMAN Interferon alpha-8 OS=Homo sapiens OX=9606 GN=IFNA8 PE=1 SV=1
20	Q9P0W0	3.53e-22	90.9	207	0.364	0.329	IFNK_HUMAN Interferon kappa OS=Homo sapiens OX=9606 GN=IFNK PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00250 Forkhead	20	16.7	Forkhead domain
2	PF00143 Interferon	4.6e-55	197.7	Interferon alpha/beta domain
3	PF00312 Ribosomal_S15	1.6e+02	13.9	Ribosomal protein S15

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000369581

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000270139	0.999	Interferon alpha/beta receptor 1
2	9606.ENSP00000343957	0.998	Interferon alpha/beta receptor 2
3	9606.ENSP00000471896	0.990	Interferon regulatory factor 3
4	9606.ENSP00000380697	0.985	Interferon regulatory factor 7
5	9606.ENSP00000354394	0.984	Signal transducer and activator of transcription 1-alpha/beta
6	9606.ENSP00000315768	0.981	Signal transducer and activator of transcription 2
7	9606.ENSP00000245414	0.975	Interferon regulatory factor 1
8	9606.ENSP00000380073	0.974	Interferon regulatory factor 9
9	9606.ENSP00000349960	0.970	Actin, cytoplasmic 1
10	9606.ENSP00000431885	0.967	Non-receptor tyrosine-protein kinase TYK2
11	9606.ENSP00000343204	0.966	Tyrosine-protein kinase JAK1
12	9606.ENSP00000349770	0.966	Interferon regulatory factor 5
13	9606.ENSP00000360266	0.963	Transcription factor AP-1
14	9606.ENSP00000259808	0.959	Receptor-interacting serine/threonine-protein kinase 1
15	9606.ENSP00000377218	0.959	Interferon regulatory factor 2
16	9606.ENSP00000384273	0.954	Transcription factor p65
17	9606.ENSP00000296795	0.952	Toll-like receptor 3
18	9606.ENSP00000345347	0.951	High mobility group protein B1
19	9606.ENSP00000306245	0.948	Proto-oncogene c-Fos
20	9606.ENSP00000363089	0.948	Toll-like receptor 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005126	1.000	cytokine receptor binding
GO:0005125	1.000	cytokine activity
GO:0003824	0.844	catalytic activity
GO:0016740	0.669	transferase activity
GO:0008374	0.616	O-acyltransferase activity
GO:0044877	0.543	protein-containing complex binding
GO:0016407	0.534	acetyltransferase activity
GO:0016413	0.492	O-acetyltransferase activity
GO:1901363	0.386	heterocyclic compound binding
GO:0097159	0.386	organic cyclic compound binding
GO:0003676	0.376	nucleic acid binding
GO:0005132	0.303	type I interferon receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0009987	0.992	cellular process
GO:0050794	0.991	regulation of cellular process
GO:0002376	0.989	immune system process
GO:0006952	0.987	defense response
GO:0009605	0.986	response to external stimulus
GO:0031323	0.982	regulation of cellular metabolic process
GO:0051607	0.980	defense response to virus
GO:0048522	0.976	positive regulation of cellular process
GO:0007165	0.975	signal transduction
GO:0006955	0.963	immune response
GO:0048523	0.962	negative regulation of cellular process
GO:0071345	0.956	cellular response to cytokine stimulus
GO:0019221	0.950	cytokine-mediated signaling pathway
GO:0045087	0.939	innate immune response
GO:0001775	0.909	cell activation
GO:0010604	0.898	positive regulation of macromolecule metabolic process
GO:0071357	0.897	cellular response to type I interferon
GO:0048583	0.892	regulation of response to stimulus
GO:0048525	0.877	negative regulation of viral process
GO:0010468	0.863	regulation of gene expression
GO:0051171	0.821	regulation of nitrogen compound metabolic process
GO:0045321	0.740	leukocyte activation
GO:0080090	0.722	regulation of primary metabolic process
GO:0140888	0.710	interferon-mediated signaling pathway
GO:0031325	0.688	positive regulation of cellular metabolic process
GO:0046649	0.682	lymphocyte activation
GO:0048584	0.678	positive regulation of response to stimulus
GO:0002682	0.676	regulation of immune system process
GO:0023056	0.650	positive regulation of signaling
GO:0010647	0.649	positive regulation of cell communication
GO:0002252	0.635	immune effector process
GO:0009967	0.628	positive regulation of signal transduction
GO:0002366	0.613	leukocyte activation involved in immune response
GO:0002285	0.544	lymphocyte activation involved in immune response
GO:0001817	0.535	regulation of cytokine production
GO:0009892	0.502	negative regulation of metabolic process
GO:0051173	0.482	positive regulation of nitrogen compound metabolic process
GO:0031326	0.477	regulation of cellular biosynthetic process
GO:0051252	0.477	regulation of RNA metabolic process
GO:0006355	0.468	regulation of DNA-templated transcription
GO:0050776	0.443	regulation of immune response
GO:0002684	0.430	positive regulation of immune system process
GO:0010628	0.419	positive regulation of gene expression
GO:0051247	0.394	positive regulation of protein metabolic process
GO:0051240	0.392	positive regulation of multicellular organismal process
GO:0031399	0.363	regulation of protein modification process
GO:0080134	0.353	regulation of response to stress
GO:0010605	0.338	negative regulation of macromolecule metabolic process
GO:0001819	0.336	positive regulation of cytokine production
GO:0032101	0.330	regulation of response to external stimulus
GO:0045893	0.316	positive regulation of DNA-templated transcription
GO:0006357	0.307	regulation of transcription by RNA polymerase II
GO:0043067	0.301	regulation of programmed cell death
GO:0042325	0.300	regulation of phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0005622	0.823	intracellular anatomical structure
GO:0005737	0.754	cytoplasm
GO:0005829	0.656	cytosol
GO:0016020	0.493	membrane
GO:0043226	0.421	organelle
GO:0043231	0.407	intracellular membrane-bounded organelle
GO:0005615	0.385	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.669	Transferases.
EC:2.3.1.-	0.616	Transferring groups other than amino-acyl groups.

[back to server]