StarFunc result for job id P01579

User Input

>input (166 residues)
MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWK
EESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTN
YSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P01579	1.000	1.000	4.168E-25	166	1.000	1.000	P01579.pdb.gz	IFNG_HUMAN Interferon gamma OS=Homo sapiens OX=9606 GN=IFNG PE=1 SV=1
2	PDB:3besL	0.782	0.973	1.520E-16	133	0.795	0.992	3besL.pdb.gz
3	AFDB:A9QXB7	0.767	0.767	2.062E-15	166	0.614	0.614	A9QXB7.pdb.gz	A9QXB7_BOVIN Interferon gamma OS=Bos taurus OX=9913 PE=2 SV=1
4	PDB:1ekuB	0.714	0.469	1.401E-12	254	0.717	0.469	1ekuB.pdb.gz
5	AFDB:P01581	0.728	0.771	4.573E-10	156	0.367	0.391	P01581.pdb.gz	IFNG_RAT Interferon gamma OS=Rattus norvegicus OX=10116 GN=Ifng PE=2 SV=1
6	AFDB:P01580	0.711	0.758	2.676E-9	155	0.367	0.394	P01580.pdb.gz	IFNG_MOUSE Interferon gamma OS=Mus musculus OX=10090 GN=Ifng PE=1 SV=1
7	AFDB:Q9YGB9	0.419	0.424	6.036E-7	164	0.349	0.354	Q9YGB9.pdb.gz	IFNG_ANAPL Interferon gamma OS=Anas platyrhynchos OX=8839 GN=IFNG PE=2 SV=1
8	AFDB:C6KJC5	0.432	0.436	4.743E-6	164	0.325	0.329	C6KJC5.pdb.gz	C6KJC5_CHICK Interferon gamma OS=Gallus gallus OX=9031 PE=2 SV=1
9	AFDB:D2D0D7	0.414	0.385	2.745E-3	180	0.187	0.172	D2D0D7.pdb.gz	D2D0D7_SALSA Interferon-gamma OS=Salmo salar OX=8030 PE=2 SV=1
10	AFDB:Q75S22	0.417	0.381	3.685E-3	185	0.211	0.189	Q75S22.pdb.gz	Q75S22_DANRE Interferon gamma OS=Danio rerio OX=7955 GN=IFNG PE=2 SV=1
11	AFDB:E3P8T5	0.413	0.383	4.946E-3	181	0.175	0.160	E3P8T5.pdb.gz	E3P8T5_ONCMY Interferon gamma2 OS=Oncorhynchus mykiss OX=8022 GN=ifng2 PE=3 SV=1
12	PDB:6f1eA	0.440	0.490	1.110E-2	143	0.139	0.161	6f1eA.pdb.gz
13	AFDB:B3IXK1	0.446	0.396	9.973E-2	198	0.157	0.131	B3IXK1.pdb.gz	IFNG_PAROL Interferon gamma OS=Paralichthys olivaceus OX=8255 GN=ifng PE=1 SV=1
14	PDB:2ilkA	0.312	0.328	1.098	155	0.120	0.129	2ilkA.pdb.gz	Crystal structure of human interleukin-10 at 1.6 A resolution and a model of a complex with its soluble receptor.
15	PDB:6weoQ	0.346	0.391	3.361	142	0.108	0.127	6weoQ.pdb.gz	The tissue protective functions of interleukin-22 can be decoupled from pro-inflammatory actions through structure-based design.
16	PDB:1lqsL	0.252	0.284	4.011	142	0.127	0.148	1lqsL.pdb.gz
17	PDB:5c0wL	0.225	0.293	4.011	113	0.096	0.142	5c0wL.pdb.gz	RNA degradation paths in a 12-subunit nuclear exosome complex.
18	PDB:4p9uE	0.173	0.116	4.786	272	0.120	0.074	4p9uE.pdb.gz	The 40-residue insertion in Vibrio cholerae FadR facilitates binding of an additional fatty acyl-CoA ligand.
19	PDB:7rroB0	0.176	0.159	5.076	189	0.114	0.101	7rroB0.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
20	PDB:6ff7p	0.144	0.138	5.711	175	0.102	0.097	6ff7p.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P01579	6.92e-123	344	166	1.000	1.000	IFNG_HUMAN Interferon gamma OS=Homo sapiens OX=9606 GN=IFNG PE=1 SV=1
2	P17773	1.01e-62	192	166	0.620	0.620	IFNG_SHEEP Interferon gamma OS=Ovis aries OX=9940 GN=IFNG PE=2 SV=1
3	E5G7F4	1.87e-61	189	166	0.620	0.620	E5G7F4_SHEEP Interferon gamma OS=Ovis aries OX=9940 GN=IFNG PE=3 SV=1
4	P07353	2.75e-60	186	166	0.614	0.614	IFNG_BOVIN Interferon gamma OS=Bos taurus OX=9913 GN=IFNG PE=1 SV=1
5	A9QXB7	3.07e-60	186	166	0.614	0.614	A9QXB7_BOVIN Interferon gamma OS=Bos taurus OX=9913 PE=2 SV=1
6	Q4TWG0	1.39e-58	181	143	0.542	0.629	Q4TWG0_SHEEP Interferon gamma (Fragment) OS=Ovis aries OX=9940 PE=2 SV=1
7	Q6PVS6	2.54e-47	151	121	0.458	0.628	Q6PVS6_SHEEP Interferon gamma (Fragment) OS=Ovis aries OX=9940 GN=IFN-gamma PE=2 SV=1
8	P01581	8.84e-40	134	156	0.367	0.391	IFNG_RAT Interferon gamma OS=Rattus norvegicus OX=10116 GN=Ifng PE=2 SV=1
9	P01580	5.38e-37	126	155	0.386	0.413	IFNG_MOUSE Interferon gamma OS=Mus musculus OX=10090 GN=Ifng PE=1 SV=1
10	Q30DS9	7.86e-25	93.2	77	0.277	0.597	Q30DS9_SHEEP Interferon gamma (Fragment) OS=Ovis aries OX=9940 GN=INFG PE=3 SV=1
11	B3F594	2.52e-24	92.0	76	0.271	0.592	B3F594_SHEEP Interferon gamma (Fragment) OS=Ovis aries OX=9940 GN=IFNG PE=3 SV=1
12	Q1WDD9	1.16e-21	84.7	65	0.247	0.631	Q1WDD9_SHEEP Interferon gamma (Fragment) OS=Ovis aries OX=9940 GN=IFNG PE=3 SV=1
13	Q9YGB9	1.50e-21	87.4	164	0.355	0.360	IFNG_ANAPL Interferon gamma OS=Anas platyrhynchos OX=8839 GN=IFNG PE=2 SV=1
14	C8CLK2	1.01e-16	75.1	164	0.277	0.280	C8CLK2_CHICK Interferon gamma OS=Gallus gallus OX=9031 PE=2 SV=1
15	P49708	1.02e-16	75.1	164	0.277	0.280	IFNG_CHICK Interferon gamma OS=Gallus gallus OX=9031 GN=IFNG PE=2 SV=1
16	C6KJC5	1.24e-16	74.7	164	0.277	0.280	C6KJC5_CHICK Interferon gamma OS=Gallus gallus OX=9031 PE=2 SV=1
17	Q66T03	1.30e-16	74.7	164	0.277	0.280	Q66T03_CHICK Interferon gamma OS=Gallus gallus OX=9031 PE=2 SV=1
18	Q2PPE0	1.45e-16	71.6	61	0.211	0.574	Q2PPE0_SHEEP Interferon gamma (Fragment) OS=Ovis aries OX=9940 GN=IFNG PE=3 SV=1
19	Q1KMD4	1.16e-15	72.0	164	0.271	0.274	Q1KMD4_CHICK Interferon gamma OS=Gallus gallus OX=9031 PE=2 SV=1
20	Q1WDE1	5.02e-10	54.3	38	0.163	0.711	Q1WDE1_SHEEP Interferon gamma (Fragment) OS=Ovis aries OX=9940 GN=IFNG PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05918 API5	36	14.6	Apoptosis inhibitory protein 5 (API5)
2	PF05738 Cna_B	2.6e+02	13.5	Cna protein B-type domain
3	PF00714 IFN-gamma	1.6e-63	224.1	Interferon gamma
4	PF08581 Tup_N	3.1e+02	13.1	Tup N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000229135

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356713	0.999	Interferon gamma receptor 1
2	9606.ENSP00000290219	0.995	Interferon gamma receptor 2
3	9606.ENSP00000365380	0.989	Forkhead box protein P3
4	9606.ENSP00000354394	0.983	Signal transducer and activator of transcription 1-alpha/beta
5	9606.ENSP00000343204	0.979	Tyrosine-protein kinase JAK1
6	9606.ENSP00000245414	0.969	Interferon regulatory factor 1
7	9606.ENSP00000371067	0.967	Tyrosine-protein kinase JAK2
8	9606.ENSP00000376134	0.967	Signal transducer and activator of transcription 4
9	9606.ENSP00000341208	0.962	Signal transducer and activator of transcription 5A
10	9606.ENSP00000329418	0.959	Suppressor of cytokine signaling 1
11	9606.ENSP00000360266	0.958	Transcription factor AP-1
12	9606.ENSP00000270139	0.952	Interferon alpha/beta receptor 1
13	9606.ENSP00000412237	0.951	Interleukin-10
14	9606.ENSP00000362795	0.947	C-X-C chemokine receptor type 3
15	9606.ENSP00000384273	0.945	Transcription factor p65
16	9606.ENSP00000385675	0.943	Interleukin-6
17	9606.ENSP00000262375	0.942	DnaJ homolog subfamily A member 3, mitochondrial
18	9606.ENSP00000011653	0.941	T-cell surface glycoprotein CD4
19	9606.ENSP00000300305	0.939	Runt-related transcription factor 1
20	9606.ENSP00000398698	0.938	Tumor necrosis factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005126	1.000	cytokine receptor binding
GO:0005133	0.984	type II interferon receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048522	0.986	positive regulation of cellular process
GO:0050896	0.983	response to stimulus
GO:0009987	0.982	cellular process
GO:0002376	0.978	immune system process
GO:0048583	0.978	regulation of response to stimulus
GO:0048519	0.973	negative regulation of biological process
GO:0051246	0.969	regulation of protein metabolic process
GO:0002682	0.968	regulation of immune system process
GO:0006950	0.967	response to stress
GO:0007165	0.966	signal transduction
GO:0032944	0.965	regulation of mononuclear cell proliferation
GO:0050670	0.962	regulation of lymphocyte proliferation
GO:0002684	0.961	positive regulation of immune system process
GO:0070665	0.959	positive regulation of leukocyte proliferation
GO:0006952	0.954	defense response
GO:0065009	0.953	regulation of molecular function
GO:0010628	0.951	positive regulation of gene expression
GO:0023051	0.950	regulation of signaling
GO:0032501	0.949	multicellular organismal process
GO:0010646	0.949	regulation of cell communication
GO:0034097	0.948	response to cytokine
GO:0001817	0.947	regulation of cytokine production
GO:0050671	0.946	positive regulation of lymphocyte proliferation
GO:0048584	0.944	positive regulation of response to stimulus
GO:0051247	0.942	positive regulation of protein metabolic process
GO:0044093	0.936	positive regulation of molecular function
GO:0007166	0.935	cell surface receptor signaling pathway
GO:0001819	0.935	positive regulation of cytokine production
GO:0071310	0.925	cellular response to organic substance
GO:0006955	0.924	immune response
GO:0042325	0.915	regulation of phosphorylation
GO:0044419	0.914	biological process involved in interspecies interaction between organisms
GO:0050793	0.914	regulation of developmental process
GO:0009892	0.912	negative regulation of metabolic process
GO:0032879	0.911	regulation of localization
GO:0045937	0.910	positive regulation of phosphate metabolic process
GO:0030155	0.906	regulation of cell adhesion
GO:0022407	0.900	regulation of cell-cell adhesion
GO:0042116	0.900	macrophage activation
GO:0001932	0.899	regulation of protein phosphorylation
GO:0048523	0.897	negative regulation of cellular process
GO:0009605	0.888	response to external stimulus
GO:0045785	0.888	positive regulation of cell adhesion
GO:0001934	0.882	positive regulation of protein phosphorylation
GO:0006954	0.877	inflammatory response
GO:0032101	0.874	regulation of response to external stimulus
GO:0080134	0.869	regulation of response to stress
GO:0031347	0.863	regulation of defense response
GO:0071345	0.863	cellular response to cytokine stimulus
GO:0042981	0.855	regulation of apoptotic process
GO:0051707	0.850	response to other organism
GO:0031326	0.845	regulation of cellular biosynthetic process
GO:0010556	0.843	regulation of macromolecule biosynthetic process
GO:0051252	0.835	regulation of RNA metabolic process
GO:0051049	0.832	regulation of transport
GO:0006355	0.830	regulation of DNA-templated transcription
GO:0010605	0.821	negative regulation of macromolecule metabolic process
GO:0045944	0.818	positive regulation of transcription by RNA polymerase II
GO:0098542	0.793	defense response to other organism
GO:0048856	0.786	anatomical structure development
GO:0051094	0.780	positive regulation of developmental process
GO:0060341	0.776	regulation of cellular localization
GO:0050864	0.771	regulation of B cell activation
GO:0050871	0.755	positive regulation of B cell activation
GO:0050730	0.754	regulation of peptidyl-tyrosine phosphorylation
GO:0050731	0.741	positive regulation of peptidyl-tyrosine phosphorylation
GO:0030888	0.739	regulation of B cell proliferation
GO:0045595	0.737	regulation of cell differentiation
GO:0042509	0.735	regulation of tyrosine phosphorylation of STAT protein
GO:0050776	0.723	regulation of immune response
GO:0030890	0.703	positive regulation of B cell proliferation
GO:0002269	0.702	leukocyte activation involved in inflammatory response
GO:0061900	0.701	glial cell activation
GO:2000026	0.693	regulation of multicellular organismal development
GO:0045428	0.675	regulation of nitric oxide biosynthetic process
GO:0051050	0.674	positive regulation of transport
GO:0009966	0.672	regulation of signal transduction
GO:1903829	0.642	positive regulation of protein localization
GO:0010647	0.641	positive regulation of cell communication
GO:0042531	0.631	positive regulation of tyrosine phosphorylation of STAT protein
GO:0050790	0.555	regulation of catalytic activity
GO:0019221	0.552	cytokine-mediated signaling pathway
GO:0051172	0.503	negative regulation of nitrogen compound metabolic process
GO:0031324	0.466	negative regulation of cellular metabolic process
GO:0048869	0.446	cellular developmental process
GO:0009967	0.446	positive regulation of signal transduction
GO:0030154	0.441	cell differentiation
GO:0007275	0.440	multicellular organism development
GO:0140888	0.393	interferon-mediated signaling pathway
GO:0048731	0.385	system development
GO:0065008	0.341	regulation of biological quality
GO:0002252	0.319	immune effector process
GO:0002366	0.305	leukocyte activation involved in immune response
GO:0007399	0.303	nervous system development
GO:0051128	0.302	regulation of cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0005615	0.961	extracellular space
GO:0005622	0.612	intracellular anatomical structure
GO:0043231	0.531	intracellular membrane-bounded organelle
GO:0071944	0.511	cell periphery
GO:0005886	0.501	plasma membrane
GO:0005737	0.356	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]