StarFunc result for job id P01583

User Input

>input (271 residues)
MAKVPDMFEDLKNCYSENEEDSSSIDHLSLNQKSFYHVSYGPLHEGCMDQSVSLSISETS
KTSKLTFKESMVVVATNGKVLKKRRLSLSQSITDDDLEAIANDSEEEIIKPRSAPFSFLS
NVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKI
TVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHP
NLFIATKQDYWVCLAGGPPSITDFQILENQA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P01583	1.000	1.000	1.988E-44	271	1.000	1.000	P01583.pdb.gz	IL1A_HUMAN Interleukin-1 alpha OS=Homo sapiens OX=9606 GN=IL1A PE=1 SV=1
2	AFDB:P01582	0.564	0.566	1.017E-29	270	0.601	0.604	P01582.pdb.gz	IL1A_MOUSE Interleukin-1 alpha OS=Mus musculus OX=10090 GN=Il1a PE=1 SV=1
3	AFDB:P16598	0.561	0.563	6.910E-29	270	0.631	0.633	P16598.pdb.gz	IL1A_RAT Interleukin-1 alpha OS=Rattus norvegicus OX=10116 GN=Il1a PE=2 SV=1
4	AFDB:M4WG34	0.474	0.483	4.977E-11	266	0.236	0.241	M4WG34.pdb.gz	M4WG34_SHEEP Multifunctional fusion protein OS=Ovis aries OX=9940 GN=IL1b PE=2 SV=2
5	AFDB:P26889	0.458	0.464	1.140E-10	267	0.247	0.251	P26889.pdb.gz	IL1B_PIG Interleukin-1 beta OS=Sus scrofa OX=9823 GN=IL1B PE=1 SV=1
6	AFDB:P10749	0.477	0.480	1.725E-10	269	0.210	0.212	P10749.pdb.gz	IL1B_MOUSE Interleukin-1 beta OS=Mus musculus OX=10090 GN=Il1b PE=1 SV=1
7	PDB:1md6A	0.401	0.664	1.742E-6	154	0.114	0.201	1md6A.pdb.gz
8	PDB:4izeA	0.381	0.635	2.257E-6	152	0.122	0.217	4izeA.pdb.gz
9	PDB:5bowA	0.393	0.655	9.135E-6	151	0.085	0.152	5bowA.pdb.gz
10	AFDB:P09038	0.373	0.353	6.523E-5	288	0.100	0.094	P09038.pdb.gz	FGF2_HUMAN Fibroblast growth factor 2 OS=Homo sapiens OX=9606 GN=FGF2 PE=1 SV=3
11	PDB:6hpiA	0.337	0.527	1.155E-4	158	0.118	0.203	6hpiA.pdb.gz
12	AFDB:P91672	0.350	0.136	2.261E-4	770	0.151	0.053	P91672.pdb.gz	P91672_DROME Fibroblast growth factor OS=Drosophila melanogaster OX=7227 GN=bnl PE=2 SV=1
13	PDB:6b0tA	0.369	0.219	9.170E-4	487	0.085	0.047	6b0tA.pdb.gz	Structural Insights into the Induced-fit Inhibition of Fascin by a Small-Molecule Inhibitor.
14	PDB:1ry7A	0.367	0.622	1.251E-3	151	0.089	0.159	1ry7A.pdb.gz
15	PDB:1hcdA	0.346	0.705	1.539E-3	118	0.081	0.186	1hcdA.pdb.gz
16	PDB:1t9fA	0.366	0.528	3.017E-3	178	0.063	0.096	1t9fA.pdb.gz
17	PDB:1irpA	0.360	0.587	3.347E-3	153	0.103	0.183	1irpA.pdb.gz
18	PDB:3f1rA	0.363	0.589	3.525E-3	157	0.070	0.121	3f1rA.pdb.gz	Homodimerization controls the fibroblast growth factor 9 subfamily's receptor binding and heparan sulfate-dependent diffusion in the extracellular matrix
19	AFDB:P16110	0.106	0.106	1.284E-2	264	0.081	0.083	P16110.pdb.gz	LEG3_MOUSE Galectin-3 OS=Mus musculus OX=10090 GN=Lgals3 PE=1 SV=3
20	AFDB:P08699	0.105	0.107	2.940E-2	262	0.096	0.099	P08699.pdb.gz	LEG3_RAT Galectin-3 OS=Rattus norvegicus OX=10116 GN=Lgals3 PE=1 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P01583	0.0	563	271	1.000	1.000	IL1A_HUMAN Interleukin-1 alpha OS=Homo sapiens OX=9606 GN=IL1A PE=1 SV=1
2	P01582	4.17e-116	335	270	0.609	0.611	IL1A_MOUSE Interleukin-1 alpha OS=Mus musculus OX=10090 GN=Il1a PE=1 SV=1
3	P16598	7.86e-116	335	270	0.638	0.641	IL1A_RAT Interleukin-1 alpha OS=Rattus norvegicus OX=10116 GN=Il1a PE=2 SV=1
4	P01584	7.76e-04	42.4	269	0.262	0.264	IL1B_HUMAN Interleukin-1 beta OS=Homo sapiens OX=9606 GN=IL1B PE=1 SV=2
5	P21621	0.002	40.8	266	0.244	0.248	IL1B_SHEEP Interleukin-1 beta OS=Ovis aries OX=9940 GN=IL1B PE=2 SV=2
6	M4WG34	0.003	40.4	266	0.244	0.248	M4WG34_SHEEP Multifunctional fusion protein OS=Ovis aries OX=9940 GN=IL1b PE=2 SV=2
7	O43645	0.090	35.4	153	0.140	0.248	O43645_HUMAN Multifunctional fusion protein (Fragment) OS=Homo sapiens OX=9606 GN=IL1b PE=2 SV=1
8	P10749	0.14	35.4	269	0.181	0.182	IL1B_MOUSE Interleukin-1 beta OS=Mus musculus OX=10090 GN=Il1b PE=1 SV=1
9	Q9VLY7	0.38	34.7	1469	0.077	0.014	Q9VLY7_DROME GH05679p OS=Drosophila melanogaster OX=7227 GN=Tep3 PE=1 SV=2
10	Q9NFV6	0.39	34.7	1469	0.077	0.014	Q9NFV6_DROME TEP3 protein OS=Drosophila melanogaster OX=7227 GN=Tep3 PE=2 SV=1
11	A8VZX9	3.6	31.6	1769	0.070	0.011	A8VZX9_AGRRH Rcorf28 OS=Agrobacterium rhizogenes OX=359 PE=1 SV=1
12	Q63264	5.3	30.8	268	0.181	0.183	IL1B_RAT Interleukin-1 beta OS=Rattus norvegicus OX=10116 GN=Il1b PE=2 SV=1
13	A9C3T3	5.6	30.8	747	0.055	0.020	A9C3T3_DANRE Solute carrier family 26 member 6 OS=Danio rerio OX=7955 GN=slc26a6 PE=3 SV=2
14	P08910	7.9	30.4	425	0.077	0.049	ABHD2_HUMAN Monoacylglycerol lipase ABHD2 OS=Homo sapiens OX=9606 GN=ABHD2 PE=1 SV=1
15	Q9QXM0	7.9	30.4	425	0.077	0.049	ABHD2_MOUSE Monoacylglycerol lipase ABHD2 OS=Mus musculus OX=10090 GN=Abhd2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00340 IL1	6.7e-34	127.5	Interleukin-1 / 18
2	PF02394 IL1_propep	4.9e-41	151.3	Interleukin-1 propeptide

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263339

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000386380	0.999	Interleukin-1 receptor type 1
2	9606.ENSP00000330959	0.998	Interleukin-1 receptor type 2
3	9606.ENSP00000263341	0.995	Interleukin-1 beta
4	9606.ENSP00000314807	0.995	Interleukin 1 receptor accessory protein
5	9606.ENSP00000357688	0.993	Protein S100-A13
6	9606.ENSP00000385675	0.993	Interleukin-6
7	9606.ENSP00000306512	0.989	Interleukin-8
8	9606.ENSP00000225474	0.987	Granulocyte colony-stimulating factor
9	9606.ENSP00000296871	0.987	Granulocyte-macrophage colony-stimulating factor
10	9606.ENSP00000412237	0.987	Interleukin-10
11	9606.ENSP00000259206	0.986	Interleukin-1 receptor antagonist protein
12	9606.ENSP00000379110	0.984	Growth-regulated alpha protein
13	9606.ENSP00000477908	0.984	C-C motif chemokine 3
14	9606.ENSP00000482259	0.984	C-C motif chemokine 4
15	9606.ENSP00000225831	0.983	C-C motif chemokine 2
16	9606.ENSP00000231449	0.983	Interleukin-4
17	9606.ENSP00000305651	0.981	C-X-C motif chemokine 10
18	9606.ENSP00000433138	0.981	Caspase-1
19	9606.ENSP00000280357	0.980	Interleukin-18
20	9606.ENSP00000401399	0.980	Myeloid differentiation primary response protein MyD88

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005125	1.000	cytokine activity
GO:0005507	0.998	copper ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.989	response to stimulus
GO:0050794	0.988	regulation of cellular process
GO:0009987	0.985	cellular process
GO:0048522	0.980	positive regulation of cellular process
GO:0051716	0.978	cellular response to stimulus
GO:0048583	0.977	regulation of response to stimulus
GO:0006950	0.976	response to stress
GO:0060255	0.976	regulation of macromolecule metabolic process
GO:0042221	0.975	response to chemical
GO:0001819	0.971	positive regulation of cytokine production
GO:0007166	0.967	cell surface receptor signaling pathway
GO:0048519	0.952	negative regulation of biological process
GO:0023051	0.934	regulation of signaling
GO:0010646	0.931	regulation of cell communication
GO:0048523	0.907	negative regulation of cellular process
GO:0009966	0.903	regulation of signal transduction
GO:0034097	0.900	response to cytokine
GO:0070887	0.886	cellular response to chemical stimulus
GO:0043408	0.886	regulation of MAPK cascade
GO:0032879	0.883	regulation of localization
GO:0071310	0.882	cellular response to organic substance
GO:0042127	0.880	regulation of cell population proliferation
GO:0051223	0.869	regulation of protein transport
GO:0051128	0.866	regulation of cellular component organization
GO:0051783	0.864	regulation of nuclear division
GO:0048856	0.850	anatomical structure development
GO:0050793	0.848	regulation of developmental process
GO:0051707	0.848	response to other organism
GO:0032501	0.846	multicellular organismal process
GO:0010941	0.837	regulation of cell death
GO:0042981	0.832	regulation of apoptotic process
GO:1901700	0.825	response to oxygen-containing compound
GO:0051726	0.825	regulation of cell cycle
GO:0043066	0.806	negative regulation of apoptotic process
GO:0051171	0.803	regulation of nitrogen compound metabolic process
GO:0031323	0.799	regulation of cellular metabolic process
GO:0051050	0.796	positive regulation of transport
GO:0048584	0.789	positive regulation of response to stimulus
GO:0031326	0.786	regulation of cellular biosynthetic process
GO:0012501	0.761	programmed cell death
GO:0009628	0.758	response to abiotic stimulus
GO:0051173	0.749	positive regulation of nitrogen compound metabolic process
GO:0080090	0.735	regulation of primary metabolic process
GO:0048585	0.728	negative regulation of response to stimulus
GO:0080134	0.726	regulation of response to stress
GO:0006915	0.724	apoptotic process
GO:0023056	0.722	positive regulation of signaling
GO:0010647	0.722	positive regulation of cell communication
GO:0031325	0.721	positive regulation of cellular metabolic process
GO:0006952	0.709	defense response
GO:2000026	0.707	regulation of multicellular organismal development
GO:0009968	0.707	negative regulation of signal transduction
GO:0045765	0.688	regulation of angiogenesis
GO:1903532	0.684	positive regulation of secretion by cell
GO:0032663	0.679	regulation of interleukin-2 production
GO:0071345	0.678	cellular response to cytokine stimulus
GO:1905952	0.675	regulation of lipid localization
GO:0051094	0.662	positive regulation of developmental process
GO:0019219	0.658	regulation of nucleobase-containing compound metabolic process
GO:0009967	0.654	positive regulation of signal transduction
GO:0009891	0.648	positive regulation of biosynthetic process
GO:0045766	0.631	positive regulation of angiogenesis
GO:0051130	0.628	positive regulation of cellular component organization
GO:0030154	0.610	cell differentiation
GO:0002376	0.539	immune system process
GO:0010556	0.539	regulation of macromolecule biosynthetic process
GO:0009611	0.538	response to wounding
GO:0051252	0.537	regulation of RNA metabolic process
GO:2001233	0.536	regulation of apoptotic signaling pathway
GO:0006954	0.513	inflammatory response
GO:2001236	0.507	regulation of extrinsic apoptotic signaling pathway
GO:1903506	0.506	regulation of nucleic acid-templated transcription
GO:0006355	0.493	regulation of DNA-templated transcription
GO:1902533	0.479	positive regulation of intracellular signal transduction
GO:0019221	0.456	cytokine-mediated signaling pathway
GO:0002682	0.450	regulation of immune system process
GO:0002684	0.443	positive regulation of immune system process
GO:0051246	0.413	regulation of protein metabolic process
GO:0006955	0.394	immune response
GO:0032101	0.391	regulation of response to external stimulus
GO:0000003	0.382	reproduction
GO:2001234	0.325	negative regulation of apoptotic signaling pathway
GO:2001237	0.318	negative regulation of extrinsic apoptotic signaling pathway
GO:0033554	0.317	cellular response to stress
GO:0065009	0.312	regulation of molecular function
GO:0008284	0.304	positive regulation of cell population proliferation
GO:0010638	0.303	positive regulation of organelle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0005829	0.996	cytosol
GO:0043231	0.783	intracellular membrane-bounded organelle
GO:0016020	0.766	membrane
GO:0071944	0.631	cell periphery
GO:0043233	0.420	organelle lumen
GO:0070013	0.414	intracellular organelle lumen
GO:0005886	0.349	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]