StarFunc result for job id P01584

User Input

>input (269 residues)
MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKG
FRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVR
SLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKE
KNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYIST
SQAENMPVFLGGTKGGQDITDFTMQFVSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P01584	1.000	1.000	1.120E-47	269	1.000	1.000	P01584.pdb.gz	IL1B_HUMAN Interleukin-1 beta OS=Homo sapiens OX=9606 GN=IL1B PE=1 SV=2
2	AFDB:P10749	0.658	0.658	3.844E-32	269	0.665	0.665	P10749.pdb.gz	IL1B_MOUSE Interleukin-1 beta OS=Mus musculus OX=10090 GN=Il1b PE=1 SV=1
3	AFDB:M4WG34	0.737	0.744	7.587E-32	266	0.595	0.602	M4WG34.pdb.gz	M4WG34_SHEEP Multifunctional fusion protein OS=Ovis aries OX=9940 GN=IL1b PE=2 SV=2
4	AFDB:Q63264	0.734	0.736	5.535E-31	268	0.665	0.668	Q63264.pdb.gz	IL1B_RAT Interleukin-1 beta OS=Rattus norvegicus OX=10116 GN=Il1b PE=2 SV=1
5	AFDB:P26889	0.656	0.661	2.951E-30	267	0.599	0.603	P26889.pdb.gz	IL1B_PIG Interleukin-1 beta OS=Sus scrofa OX=9823 GN=IL1B PE=1 SV=1
6	AFDB:A3DTN2	0.501	0.505	2.752E-18	267	0.301	0.303	A3DTN2.pdb.gz	A3DTN2_ANAPL Interleukin-1 OS=Anas platyrhynchos OX=8839 PE=2 SV=1
7	AFDB:A3DTN4	0.510	0.510	5.155E-18	269	0.305	0.305	A3DTN4.pdb.gz	A3DTN4_COLLI Interleukin-1 OS=Columba livia OX=8932 PE=2 SV=1
8	AFDB:Q9D6Z6	0.520	0.750	7.788E-14	183	0.201	0.295	Q9D6Z6.pdb.gz	IL36B_MOUSE Interleukin-36 beta OS=Mus musculus OX=10090 GN=Il36b PE=2 SV=1
9	AFDB:P18510	0.486	0.724	5.987E-13	177	0.152	0.232	P18510.pdb.gz	IL1RA_HUMAN Interleukin-1 receptor antagonist protein OS=Homo sapiens OX=9606 GN=IL1RN PE=1 SV=1
10	AFDB:P16598	0.460	0.458	8.634E-13	270	0.204	0.204	P16598.pdb.gz	IL1A_RAT Interleukin-1 alpha OS=Rattus norvegicus OX=10116 GN=Il1a PE=2 SV=1
11	PDB:4izeA	0.494	0.844	2.606E-10	152	0.126	0.224	4izeA.pdb.gz
12	PDB:1md6A	0.487	0.819	1.542E-9	154	0.156	0.273	1md6A.pdb.gz
13	PDB:5bowA	0.476	0.805	5.702E-9	151	0.123	0.219	5bowA.pdb.gz
14	PDB:6hpiA	0.447	0.709	5.128E-8	158	0.156	0.266	6hpiA.pdb.gz
15	PDB:1irpA	0.433	0.705	9.592E-7	153	0.149	0.261	1irpA.pdb.gz
16	PDB:1t9fA	0.384	0.550	1.613E-4	178	0.059	0.090	1t9fA.pdb.gz
17	PDB:3nbcA	0.360	0.591	1.451E-3	148	0.052	0.095	3nbcA.pdb.gz	Bivalent carbohydrate binding is required for biological activity of Clitocybe nebularis lectin (CNL), the N,N'-diacetyllactosediamine (GalNAc beta 1-4GlcNAc, LacdiNAc)-specific lectin from basidiomycete C. nebularis
18	PDB:3malA	0.385	0.544	1.529E-3	181	0.056	0.083	3malA.pdb.gz
19	PDB:7tzcA	0.299	0.025	5.653E-3	4404	0.074	0.005	7tzcA.pdb.gz	A drug and ATP binding site in type 1 ryanodine receptor.
20	PDB:4qd2C	0.376	0.356	6.613E-3	286	0.067	0.063	4qd2C.pdb.gz	Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P01584	0.0	560	269	1.000	1.000	IL1B_HUMAN Interleukin-1 beta OS=Homo sapiens OX=9606 GN=IL1B PE=1 SV=2
2	P10749	1.03e-123	355	269	0.688	0.688	IL1B_MOUSE Interleukin-1 beta OS=Mus musculus OX=10090 GN=Il1b PE=1 SV=1
3	Q63264	1.98e-118	341	268	0.665	0.668	IL1B_RAT Interleukin-1 beta OS=Rattus norvegicus OX=10116 GN=Il1b PE=2 SV=1
4	P26889	3.87e-110	320	267	0.602	0.607	IL1B_PIG Interleukin-1 beta OS=Sus scrofa OX=9823 GN=IL1B PE=1 SV=1
5	O43645	1.93e-108	311	153	0.565	0.993	O43645_HUMAN Multifunctional fusion protein (Fragment) OS=Homo sapiens OX=9606 GN=IL1b PE=2 SV=1
6	P21621	6.32e-107	312	266	0.599	0.605	IL1B_SHEEP Interleukin-1 beta OS=Ovis aries OX=9940 GN=IL1B PE=2 SV=2
7	M4WG34	3.59e-106	310	266	0.595	0.602	M4WG34_SHEEP Multifunctional fusion protein OS=Ovis aries OX=9940 GN=IL1b PE=2 SV=2
8	Q0R3N6	6.48e-38	132	137	0.268	0.526	Q0R3N6_SHEEP Interleukin-1 beta (Fragment) OS=Ovis aries OX=9940 GN=IL1B PE=3 SV=1
9	A3DTN4	9.69e-31	117	269	0.335	0.335	A3DTN4_COLLI Interleukin-1 OS=Columba livia OX=8932 PE=2 SV=1
10	A3DTN5	1.14e-30	117	267	0.286	0.288	A3DTN5_MELGA Interleukin-1 OS=Meleagris gallopavo OX=9103 GN=IL1RN PE=2 SV=1
11	A3DTN2	1.58e-28	111	267	0.271	0.273	A3DTN2_ANAPL Interleukin-1 OS=Anas platyrhynchos OX=8839 PE=2 SV=1
12	O73909	1.58e-28	111	267	0.271	0.273	O73909_CHICK Interleukin-1 OS=Gallus gallus OX=9031 GN=il-1beta PE=1 SV=1
13	F4ZWC1	2.09e-28	111	267	0.271	0.273	F4ZWC1_CHICK Interleukin-1 OS=Gallus gallus OX=9031 PE=2 SV=1
14	A3DTN3	4.00e-28	110	267	0.271	0.273	A3DTN3_9AVES Interleukin-1 OS=Anser anser OX=8843 PE=2 SV=1
15	E9LHC8	4.54e-28	110	267	0.271	0.273	E9LHC8_CHICK Interleukin-1 OS=Gallus gallus OX=9031 PE=2 SV=1
16	Q90W84	4.98e-20	88.6	261	0.260	0.268	Q90W84_DICLA Interleukin-1 OS=Dicentrarchus labrax OX=13489 GN=IL-1b PE=2 SV=1
17	Q8UUQ3	4.01e-16	77.8	260	0.264	0.273	Q8UUQ3_ONCMY Interleukin-1 OS=Oncorhynchus mykiss OX=8022 GN=IL1B1S PE=3 SV=1
18	A0A060WTK5	4.43e-16	77.8	260	0.264	0.273	A0A060WTK5_ONCMY Interleukin-1 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00005489001 PE=3 SV=1
19	Q9YGD3	4.43e-16	77.8	260	0.264	0.273	IL1B_ONCMY Interleukin-1 beta OS=Oncorhynchus mykiss OX=8022 GN=il1b PE=2 SV=1
20	Q9PT12	2.80e-15	75.5	254	0.238	0.252	Q9PT12_ONCMY Interleukin-1 OS=Oncorhynchus mykiss OX=8022 GN=IL-1 beta 2 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00340 IL1	2.1e-42	154.9	Interleukin-1 / 18
2	PF02394 IL1_propep	5e-34	128.7	Interleukin-1 propeptide

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263341

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000314807	0.999	Interleukin 1 receptor accessory protein
2	9606.ENSP00000330959	0.999	Interleukin-1 receptor type 2
3	9606.ENSP00000386380	0.999	Interleukin-1 receptor type 1
4	9606.ENSP00000433138	0.999	Caspase-1
5	9606.ENSP00000306512	0.998	Interleukin-8
6	9606.ENSP00000385675	0.997	Interleukin-6
7	9606.ENSP00000379110	0.996	Growth-regulated alpha protein
8	9606.ENSP00000477908	0.996	C-C motif chemokine 3
9	9606.ENSP00000263339	0.995	Interleukin-1 alpha
10	9606.ENSP00000412237	0.995	Interleukin-10
11	9606.ENSP00000482259	0.995	C-C motif chemokine 4
12	9606.ENSP00000280357	0.994	Interleukin-18
13	9606.ENSP00000427279	0.994	C-X-C motif chemokine 2
14	9606.ENSP00000225831	0.993	C-C motif chemokine 2
15	9606.ENSP00000401399	0.991	Myeloid differentiation primary response protein MyD88
16	9606.ENSP00000231449	0.990	Interleukin-4
17	9606.ENSP00000296871	0.988	Granulocyte-macrophage colony-stimulating factor
18	9606.ENSP00000305651	0.988	C-X-C motif chemokine 10
19	9606.ENSP00000351671	0.988	C-C motif chemokine 20
20	9606.ENSP00000474412	0.988	C-C motif chemokine 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005125	1.000	cytokine activity
GO:0044877	0.721	protein-containing complex binding
GO:0050839	0.716	cell adhesion molecule binding
GO:0005178	0.688	integrin binding
GO:0019904	0.687	protein domain specific binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0050794	0.995	regulation of cellular process
GO:0048522	0.993	positive regulation of cellular process
GO:0009987	0.990	cellular process
GO:0006950	0.985	response to stress
GO:0060255	0.985	regulation of macromolecule metabolic process
GO:0002831	0.982	regulation of response to biotic stimulus
GO:0006952	0.981	defense response
GO:0009605	0.979	response to external stimulus
GO:0009607	0.977	response to biotic stimulus
GO:0051716	0.972	cellular response to stimulus
GO:0080090	0.972	regulation of primary metabolic process
GO:0051707	0.972	response to other organism
GO:0048584	0.970	positive regulation of response to stimulus
GO:0009966	0.970	regulation of signal transduction
GO:0023052	0.969	signaling
GO:0023056	0.966	positive regulation of signaling
GO:0010647	0.966	positive regulation of cell communication
GO:0050691	0.965	regulation of defense response to virus by host
GO:0007154	0.964	cell communication
GO:0009893	0.964	positive regulation of metabolic process
GO:0032879	0.959	regulation of localization
GO:1902531	0.958	regulation of intracellular signal transduction
GO:0042221	0.953	response to chemical
GO:0051171	0.953	regulation of nitrogen compound metabolic process
GO:0010604	0.953	positive regulation of macromolecule metabolic process
GO:0048519	0.941	negative regulation of biological process
GO:0001819	0.940	positive regulation of cytokine production
GO:0001932	0.940	regulation of protein phosphorylation
GO:0051049	0.938	regulation of transport
GO:0032103	0.937	positive regulation of response to external stimulus
GO:0032675	0.936	regulation of interleukin-6 production
GO:0032755	0.931	positive regulation of interleukin-6 production
GO:0032501	0.929	multicellular organismal process
GO:0010033	0.927	response to organic substance
GO:0002684	0.901	positive regulation of immune system process
GO:0051046	0.900	regulation of secretion
GO:0051173	0.890	positive regulation of nitrogen compound metabolic process
GO:0031325	0.889	positive regulation of cellular metabolic process
GO:0048523	0.879	negative regulation of cellular process
GO:0070887	0.866	cellular response to chemical stimulus
GO:1903530	0.860	regulation of secretion by cell
GO:0048856	0.849	anatomical structure development
GO:0098542	0.848	defense response to other organism
GO:1902533	0.839	positive regulation of intracellular signal transduction
GO:1901700	0.837	response to oxygen-containing compound
GO:0030335	0.836	positive regulation of cell migration
GO:0042327	0.835	positive regulation of phosphorylation
GO:0009617	0.828	response to bacterium
GO:0001934	0.825	positive regulation of protein phosphorylation
GO:0050793	0.824	regulation of developmental process
GO:0065009	0.815	regulation of molecular function
GO:0065008	0.813	regulation of biological quality
GO:0006954	0.813	inflammatory response
GO:0043408	0.808	regulation of MAPK cascade
GO:0050790	0.791	regulation of catalytic activity
GO:0009892	0.791	negative regulation of metabolic process
GO:0044093	0.787	positive regulation of molecular function
GO:0045859	0.784	regulation of protein kinase activity
GO:0043410	0.771	positive regulation of MAPK cascade
GO:0051050	0.750	positive regulation of transport
GO:0007165	0.749	signal transduction
GO:0007275	0.745	multicellular organism development
GO:0043122	0.744	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0051094	0.739	positive regulation of developmental process
GO:0002376	0.724	immune system process
GO:0042127	0.703	regulation of cell population proliferation
GO:0071310	0.700	cellular response to organic substance
GO:0032496	0.695	response to lipopolysaccharide
GO:0009889	0.689	regulation of biosynthetic process
GO:2000026	0.684	regulation of multicellular organismal development
GO:0043405	0.684	regulation of MAP kinase activity
GO:0031326	0.679	regulation of cellular biosynthetic process
GO:0010556	0.677	regulation of macromolecule biosynthetic process
GO:0019219	0.676	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.671	regulation of DNA-templated transcription
GO:0048585	0.656	negative regulation of response to stimulus
GO:0010605	0.642	negative regulation of macromolecule metabolic process
GO:0031328	0.627	positive regulation of cellular biosynthetic process
GO:0051047	0.618	positive regulation of secretion
GO:0051179	0.611	localization
GO:0010817	0.579	regulation of hormone levels
GO:0007166	0.566	cell surface receptor signaling pathway
GO:0022603	0.559	regulation of anatomical structure morphogenesis
GO:0071704	0.556	organic substance metabolic process
GO:0014070	0.550	response to organic cyclic compound
GO:0010941	0.544	regulation of cell death
GO:0042742	0.508	defense response to bacterium
GO:1901698	0.453	response to nitrogen compound
GO:0051128	0.419	regulation of cellular component organization
GO:0051241	0.385	negative regulation of multicellular organismal process
GO:0006955	0.350	immune response
GO:0043067	0.349	regulation of programmed cell death

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0005622	0.955	intracellular anatomical structure
GO:0005737	0.930	cytoplasm
GO:0005829	0.904	cytosol
GO:0043226	0.819	organelle
GO:0043231	0.782	intracellular membrane-bounded organelle
GO:0071944	0.773	cell periphery
GO:0016020	0.680	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]