StarFunc result for job id P01588

User Input

>input (193 residues)
MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHC
SLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQL
HVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKL
KLYTGEACRTGDR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P01588	1.000	1.000	8.174E-31	193	1.000	1.000	P01588.pdb.gz	EPO_HUMAN Erythropoietin OS=Homo sapiens OX=9606 GN=EPO PE=1 SV=1
2	AFDB:P07321	0.830	0.834	1.330E-21	192	0.788	0.792	P07321.pdb.gz	EPO_MOUSE Erythropoietin OS=Mus musculus OX=10090 GN=Epo PE=2 SV=1
3	PDB:1buyA	0.718	0.821	1.240E-18	166	0.845	0.982	1buyA.pdb.gz
4	AFDB:Q2XNF5	0.702	0.738	3.321E-11	183	0.347	0.366	Q2XNF5.pdb.gz	EPO_DANRE Erythropoietin OS=Danio rerio OX=7955 GN=epo PE=1 SV=1
5	AFDB:P40225	0.707	0.411	7.866E-8	353	0.197	0.108	P40225.pdb.gz	TPO_HUMAN Thrombopoietin OS=Homo sapiens OX=9606 GN=THPO PE=1 SV=1
6	AFDB:P49745	0.703	0.437	3.246E-7	326	0.197	0.117	P49745.pdb.gz	TPO_RAT Thrombopoietin OS=Rattus norvegicus OX=10116 GN=Thpo PE=2 SV=1
7	AFDB:P40226	0.642	0.365	1.206E-6	356	0.187	0.101	P40226.pdb.gz	TPO_MOUSE Thrombopoietin OS=Mus musculus OX=10090 GN=Thpo PE=2 SV=1
8	AFDB:B5L331	0.637	0.643	1.350E-5	191	0.181	0.183	B5L331.pdb.gz	B5L331_DANRE Thrombopoietin OS=Danio rerio OX=7955 GN=Tpo PE=2 SV=1
9	AFDB:P83714	0.393	0.376	3.715E-3	204	0.187	0.176	P83714.pdb.gz	CTF2_MOUSE Cardiotrophin-2 OS=Mus musculus OX=10090 GN=Ctf2 PE=1 SV=1
10	AFDB:F1QP70	0.476	0.412	3.915E-3	231	0.197	0.165	F1QP70.pdb.gz
11	AFDB:Q8K3I6	0.396	0.348	4.126E-3	234	0.187	0.154	Q8K3I6.pdb.gz	IL27A_MOUSE Interleukin-27 subunit alpha OS=Mus musculus OX=10090 GN=Il27 PE=1 SV=1
12	PDB:7u7nD	0.461	0.460	1.397E-2	191	0.124	0.126	7u7nD.pdb.gz
13	PDB:7zxkC	0.387	0.435	1.914E-2	166	0.150	0.175	7zxkC.pdb.gz
14	PDB:1huwA	0.312	0.353	1.408E-1	166	0.114	0.133	1huwA.pdb.gz
15	PDB:1rw5A	0.365	0.357	2.380E-1	199	0.078	0.075	1rw5A.pdb.gz
16	PDB:1rhgB	0.251	0.319	3.261E-1	144	0.098	0.132	1rhgB.pdb.gz
17	PDB:1itlA	0.332	0.425	4.468E-1	130	0.114	0.169	1itlA.pdb.gz
18	PDB:4dohA	0.358	0.432	4.709E-1	153	0.083	0.105	4dohA.pdb.gz
19	PDB:3og6A	0.414	0.525	4.963E-1	143	0.114	0.154	3og6A.pdb.gz
20	PDB:1bp3A	0.302	0.310	5.809E-1	186	0.135	0.140	1bp3A.pdb.gz	The X-ray structure of a growth hormone-prolactin receptor complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P01588	4.16e-141	392	193	1.000	1.000	EPO_HUMAN Erythropoietin OS=Homo sapiens OX=9606 GN=EPO PE=1 SV=1
2	P29676	1.32e-97	283	192	0.710	0.714	EPO_RAT Erythropoietin OS=Rattus norvegicus OX=10116 GN=Epo PE=2 SV=1
3	P07321	2.54e-95	277	192	0.689	0.693	EPO_MOUSE Erythropoietin OS=Mus musculus OX=10090 GN=Epo PE=2 SV=1
4	Q2XNF5	1.15e-28	107	183	0.342	0.361	EPO_DANRE Erythropoietin OS=Danio rerio OX=7955 GN=epo PE=1 SV=1
5	P40225	1.0	32.3	353	0.119	0.065	TPO_HUMAN Thrombopoietin OS=Homo sapiens OX=9606 GN=THPO PE=1 SV=1
6	Q8VHE6	1.9	31.6	4621	0.104	0.004	DYH5_MOUSE Dynein axonemal heavy chain 5 OS=Mus musculus OX=10090 GN=Dnah5 PE=1 SV=2
7	Q03327	2.5	31.2	502	0.135	0.052	UGO1_YEAST Mitochondrial fusion and transport protein UGO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UGO1 PE=1 SV=3
8	P40226	2.7	30.8	356	0.104	0.056	TPO_MOUSE Thrombopoietin OS=Mus musculus OX=10090 GN=Thpo PE=2 SV=1
9	P37024	3.5	30.8	809	0.119	0.028	HRPB_ECOLI ATP-dependent RNA helicase HrpB OS=Escherichia coli (strain K12) OX=83333 GN=hrpB PE=1 SV=3
10	P49745	3.5	30.4	326	0.104	0.061	TPO_RAT Thrombopoietin OS=Rattus norvegicus OX=10116 GN=Thpo PE=2 SV=1
11	Q8TE73	5.9	30.0	4624	0.098	0.004	DYH5_HUMAN Dynein axonemal heavy chain 5 OS=Homo sapiens OX=9606 GN=DNAH5 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00758 EPO_TPO	2.4e-67	237.5	Erythropoietin/thrombopoietin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000252723

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000222139	0.999	Erythropoietin receptor
2	9606.ENSP00000228280	0.994	Kit ligand
3	9606.ENSP00000437955	0.989	Hypoxia-inducible factor 1-alpha
4	9606.ENSP00000371067	0.983	Tyrosine-protein kinase JAK2
5	9606.ENSP00000204615	0.979	Thrombopoietin
6	9606.ENSP00000293328	0.979	Signal transducer and activator of transcription 5B
7	9606.ENSP00000341208	0.970	Signal transducer and activator of transcription 5A
8	9606.ENSP00000351407	0.970	Aryl hydrocarbon receptor nuclear translocator
9	9606.ENSP00000225474	0.968	Granulocyte colony-stimulating factor
10	9606.ENSP00000288135	0.968	Mast/stem cell growth factor receptor Kit
11	9606.ENSP00000263734	0.965	Endothelial PAS domain-containing protein 1
12	9606.ENSP00000263253	0.953	Histone acetyltransferase p300
13	9606.ENSP00000354394	0.947	Signal transducer and activator of transcription 1-alpha/beta
14	9606.ENSP00000401303	0.943	SHC-transforming protein 1
15	9606.ENSP00000361548	0.942	Thrombopoietin receptor
16	9606.ENSP00000345492	0.939	SH2B adapter protein 3
17	9606.ENSP00000360266	0.937	Transcription factor AP-1
18	9606.ENSP00000330341	0.936	Suppressor of cytokine signaling 3
19	9606.ENSP00000407586	0.930	GTPase HRas
20	9606.ENSP00000346300	0.929	Crk-like protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005128	1.000	erythropoietin receptor binding
GO:0005125	0.997	cytokine activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0050896	0.989	response to stimulus
GO:0009987	0.988	cellular process
GO:0019222	0.985	regulation of metabolic process
GO:0048523	0.980	negative regulation of cellular process
GO:0048518	0.975	positive regulation of biological process
GO:0048522	0.974	positive regulation of cellular process
GO:0002376	0.969	immune system process
GO:0048583	0.968	regulation of response to stimulus
GO:0032501	0.966	multicellular organismal process
GO:0080090	0.960	regulation of primary metabolic process
GO:0051171	0.958	regulation of nitrogen compound metabolic process
GO:0010941	0.958	regulation of cell death
GO:0031323	0.958	regulation of cellular metabolic process
GO:0010604	0.958	positive regulation of macromolecule metabolic process
GO:0006950	0.953	response to stress
GO:0051716	0.953	cellular response to stimulus
GO:0009966	0.953	regulation of signal transduction
GO:0042221	0.944	response to chemical
GO:0048856	0.941	anatomical structure development
GO:0001934	0.940	positive regulation of protein phosphorylation
GO:0009967	0.919	positive regulation of signal transduction
GO:0010468	0.915	regulation of gene expression
GO:0009628	0.909	response to abiotic stimulus
GO:0007154	0.909	cell communication
GO:0042981	0.906	regulation of apoptotic process
GO:0023052	0.903	signaling
GO:0065009	0.898	regulation of molecular function
GO:0010033	0.882	response to organic substance
GO:0009889	0.875	regulation of biosynthetic process
GO:0030154	0.873	cell differentiation
GO:0006355	0.865	regulation of DNA-templated transcription
GO:0007165	0.853	signal transduction
GO:0048871	0.839	multicellular organismal-level homeostasis
GO:0042127	0.833	regulation of cell population proliferation
GO:0030097	0.817	hemopoiesis
GO:0030099	0.801	myeloid cell differentiation
GO:0008284	0.778	positive regulation of cell population proliferation
GO:0060548	0.774	negative regulation of cell death
GO:0007166	0.743	cell surface receptor signaling pathway
GO:1902531	0.737	regulation of intracellular signal transduction
GO:0034097	0.726	response to cytokine
GO:1902533	0.720	positive regulation of intracellular signal transduction
GO:0070887	0.715	cellular response to chemical stimulus
GO:0071310	0.710	cellular response to organic substance
GO:0006357	0.684	regulation of transcription by RNA polymerase II
GO:1903508	0.590	positive regulation of nucleic acid-templated transcription
GO:0032879	0.586	regulation of localization
GO:0071704	0.581	organic substance metabolic process
GO:0044238	0.556	primary metabolic process
GO:0009892	0.552	negative regulation of metabolic process
GO:0071345	0.544	cellular response to cytokine stimulus
GO:0010605	0.504	negative regulation of macromolecule metabolic process
GO:0043066	0.487	negative regulation of apoptotic process
GO:0065008	0.473	regulation of biological quality
GO:0044237	0.470	cellular metabolic process
GO:0019221	0.468	cytokine-mediated signaling pathway
GO:0006807	0.465	nitrogen compound metabolic process
GO:0007275	0.460	multicellular organism development
GO:0051239	0.450	regulation of multicellular organismal process
GO:0051049	0.430	regulation of transport
GO:0048872	0.407	homeostasis of number of cells
GO:0050730	0.405	regulation of peptidyl-tyrosine phosphorylation
GO:0002262	0.402	myeloid cell homeostasis
GO:0050793	0.382	regulation of developmental process
GO:0050731	0.343	positive regulation of peptidyl-tyrosine phosphorylation
GO:0043170	0.342	macromolecule metabolic process
GO:0048731	0.325	system development
GO:1901564	0.316	organonitrogen compound metabolic process
GO:0044093	0.301	positive regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.998	extracellular space
GO:0071944	0.909	cell periphery
GO:0005886	0.889	plasma membrane
GO:0005622	0.794	intracellular anatomical structure
GO:0005737	0.719	cytoplasm
GO:0009986	0.714	cell surface
GO:0043231	0.661	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]