StarFunc result for job id P01589

User Input

>input (272 residues)
MDSYLLMWGLLTFIMVPGCQAELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKS
GSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQAS
LPGHCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQP
QLICTGEMETSQFPGEEKPQASPEGRPESETSCLVTTTDFQIQTEMAATMETSIFTTEYQ
VAVAGCVFLLISVLLLSGLTWQRRQRKSRRTI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P01589	1.000	1.000	1.733E-45	272	1.000	1.000	P01589.pdb.gz	IL2RA_HUMAN Interleukin-2 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL2RA PE=1 SV=1
2	AFDB:P26897	0.585	0.595	9.075E-26	267	0.559	0.569	P26897.pdb.gz	IL2RA_RAT Interleukin-2 receptor subunit alpha OS=Rattus norvegicus OX=10116 GN=Il2ra PE=2 SV=1
3	AFDB:P01590	0.540	0.547	2.100E-23	268	0.529	0.537	P01590.pdb.gz	IL2RA_MOUSE Interleukin-2 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il2ra PE=2 SV=1
4	PDB:2xwbF	0.123	0.052	5.636E-3	714	0.110	0.042	2xwbF.pdb.gz	Structures of C3B in Complex with Factors B and D Give Insight Into Complement Convertase Formation.
5	PDB:2q7zA	0.167	0.033	6.305E-3	1931	0.140	0.020	2q7zA.pdb.gz
6	PDB:2gsxA	0.144	0.046	1.045E-2	951	0.088	0.025	2gsxA.pdb.gz
7	AFDB:Q60819	0.161	0.166	1.537E-2	263	0.162	0.167	Q60819.pdb.gz	I15RA_MOUSE Interleukin-15 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il15ra PE=1 SV=1
8	PDB:4e0sB	0.127	0.043	3.211E-2	898	0.110	0.033	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
9	PDB:1c1zA	0.139	0.118	4.251E-2	326	0.085	0.071	1c1zA.pdb.gz
10	PDB:3t5oA	0.139	0.048	5.628E-2	871	0.103	0.032	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
11	PDB:8a7dQ	0.135	0.134	3.794E-1	273	0.096	0.095	8a7dQ.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
12	AFDB:P0C0K5	0.208	0.202	4.717E-1	282	0.114	0.110	P0C0K5.pdb.gz	HAVR2_RAT Hepatitis A virus cellular receptor 2 homolog OS=Rattus norvegicus OX=10116 GN=Havcr2 PE=2 SV=2
13	PDB:4a5wB	0.145	0.047	4.748E-1	871	0.040	0.013	4a5wB.pdb.gz	Assembly and Regulation of the Membrane Attack Complex Based on Structures of C5B6 and Sc5B9.
14	PDB:8a7eC	0.129	0.027	5.023E-1	1524	0.077	0.014	8a7eC.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
15	AFDB:O76036	0.161	0.146	6.605E-1	304	0.085	0.076	O76036.pdb.gz	NCTR1_HUMAN Natural cytotoxicity triggering receptor 1 OS=Homo sapiens OX=9606 GN=NCR1 PE=1 SV=1
16	AFDB:Q7TQK9	0.096	0.083	7.817E-1	378	0.129	0.093	Q7TQK9.pdb.gz	Q7TQK9_MOUSE Arhgef11 protein (Fragment) OS=Mus musculus OX=10090 GN=Arhgef11 PE=2 SV=1
17	PDB:7nycC	0.143	0.051	7.869E-1	809	0.066	0.022	7nycC.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
18	AFDB:P54867	0.154	0.113	1.035	378	0.099	0.071	P54867.pdb.gz	SLG1_YEAST Protein SLG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SLG1 PE=1 SV=1
19	AFDB:Q8VIM0	0.166	0.161	1.533	281	0.121	0.117	Q8VIM0.pdb.gz	HAVR2_MOUSE Hepatitis A virus cellular receptor 2 homolog OS=Mus musculus OX=10090 GN=Havcr2 PE=1 SV=1
20	AFDB:Q8LPT3	0.099	0.045	1.919	761	0.132	0.047	Q8LPT3.pdb.gz	MEBL_ARATH Membrane protein of ER body-like protein OS=Arabidopsis thaliana OX=3702 GN=MEBL PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P01589	0.0	569	272	1.000	1.000	IL2RA_HUMAN Interleukin-2 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL2RA PE=1 SV=1
2	P26897	6.83e-111	322	267	0.607	0.618	IL2RA_RAT Interleukin-2 receptor subunit alpha OS=Rattus norvegicus OX=10116 GN=Il2ra PE=2 SV=1
3	P01590	1.16e-102	301	268	0.603	0.612	IL2RA_MOUSE Interleukin-2 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il2ra PE=2 SV=1
4	A0A8I5ZMB7	0.037	37.7	422	0.151	0.097	A0A8I5ZMB7_RAT CD55 molecule (Cromer blood group) OS=Rattus norvegicus OX=10116 GN=Cd55 PE=4 SV=1
5	Q9Z0M0	0.039	37.4	399	0.151	0.103	Q9Z0M0_RAT CD55 molecule (Cromer blood group) OS=Rattus norvegicus OX=10116 GN=Cd55 PE=1 SV=1
6	Q9Z0L9	0.046	37.4	466	0.151	0.088	Q9Z0L9_RAT Decay accelarating factor 1, isoform CRA_c OS=Rattus norvegicus OX=10116 GN=Cd55 PE=2 SV=1
7	A0A1D5NSM8	0.092	36.6	3615	0.143	0.011	A0A1D5NSM8_DANRE Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing 1 OS=Danio rerio OX=7955 GN=svep1 PE=4 SV=1
8	D3Z9F7	0.18	35.8	1406	0.206	0.040	D3Z9F7_RAT Complement C3d receptor 2 OS=Rattus norvegicus OX=10116 GN=Cr2 PE=4 SV=3
9	Q9GLM0	0.23	35.0	498	0.180	0.098	Q9GLM0_PIG Decay-accelerating factor CD55 OS=Sus scrofa OX=9823 PE=2 SV=1
10	Q9GLM1	0.31	34.7	326	0.147	0.123	Q9GLM1_PIG Decay-accelerating factor CD55 OS=Sus scrofa OX=9823 PE=2 SV=1
11	A2AVA0	0.39	34.7	3567	0.118	0.009	SVEP1_MOUSE Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Mus musculus OX=10090 GN=Svep1 PE=1 SV=1
12	Q9GLM2	0.47	34.3	341	0.165	0.132	Q9GLM2_PIG Decay-accelerating factor CD55 OS=Sus scrofa OX=9823 GN=CD55 PE=2 SV=1
13	Q9Z0M4	0.47	34.3	355	0.059	0.045	MCP_RAT Membrane cofactor protein OS=Rattus norvegicus OX=10116 GN=Cd46 PE=1 SV=1
14	P19070	0.95	33.5	1025	0.210	0.056	CR2_MOUSE Complement receptor type 2 OS=Mus musculus OX=10090 GN=Cr2 PE=1 SV=1
15	A0A8I5XWT0	1.2	33.1	773	0.066	0.023	A0A8I5XWT0_RAT CD55 molecule (Cromer blood group) OS=Rattus norvegicus OX=10116 GN=Cd55 PE=1 SV=1
16	P17927	1.6	32.7	2039	0.062	0.008	CR1_HUMAN Complement receptor type 1 OS=Homo sapiens OX=9606 GN=CR1 PE=1 SV=3
17	Q63514	1.6	32.7	558	0.059	0.029	C4BPA_RAT C4b-binding protein alpha chain OS=Rattus norvegicus OX=10116 GN=C4bpa PE=2 SV=1
18	P08603	2.0	32.3	1231	0.070	0.015	CFAH_HUMAN Complement factor H OS=Homo sapiens OX=9606 GN=CFH PE=1 SV=4
19	P20023	2.3	32.3	1033	0.195	0.051	CR2_HUMAN Complement receptor type 2 OS=Homo sapiens OX=9606 GN=CR2 PE=1 SV=2
20	Q60736	2.8	32.0	579	0.154	0.073	ZP3R_MOUSE Zona pellucida sperm-binding protein 3 receptor OS=Mus musculus OX=10090 GN=Zp3r PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00084 Sushi	0.003	29.3	Sushi repeat (SCR repeat)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000369293

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216223	0.999	Interleukin-2 receptor subunit beta
2	9606.ENSP00000226730	0.999	Interleukin-2
3	9606.ENSP00000363318	0.998	Cytokine receptor common subunit gamma
4	9606.ENSP00000365380	0.995	Forkhead box protein P3
5	9606.ENSP00000293328	0.989	Signal transducer and activator of transcription 5B
6	9606.ENSP00000391676	0.989	Tyrosine-protein kinase JAK3
7	9606.ENSP00000337825	0.987	Tyrosine-protein kinase Lck
8	9606.ENSP00000341208	0.980	Signal transducer and activator of transcription 5A
9	9606.ENSP00000386559	0.976	T-cell surface glycoprotein CD8 alpha chain
10	9606.ENSP00000264657	0.968	Signal transducer and activator of transcription 3
11	9606.ENSP00000364907	0.968	Tyrosine-protein kinase SYK
12	9606.ENSP00000376345	0.968	Growth factor receptor-bound protein 2
13	9606.ENSP00000401303	0.964	SHC-transforming protein 1
14	9606.ENSP00000428056	0.963	Phosphatidylinositol 3-kinase regulatory subunit alpha
15	9606.ENSP00000354566	0.957	T-cell surface glycoprotein CD3 epsilon chain
16	9606.ENSP00000343204	0.949	Tyrosine-protein kinase JAK1
17	9606.ENSP00000354394	0.945	Signal transducer and activator of transcription 1-alpha/beta
18	9606.ENSP00000451828	0.944	RAC-alpha serine/threonine-protein kinase
19	9606.ENSP00000354952	0.943	GRB2-associated-binding protein 2
20	9606.ENSP00000354782	0.942	T-cell surface glycoprotein CD3 zeta chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004911	1.000	interleukin-2 receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007165	0.996	signal transduction
GO:0008219	0.988	cell death
GO:0002376	0.974	immune system process
GO:0007166	0.957	cell surface receptor signaling pathway
GO:0012501	0.921	programmed cell death
GO:0002682	0.911	regulation of immune system process
GO:0006955	0.897	immune response
GO:0048518	0.854	positive regulation of biological process
GO:0048522	0.733	positive regulation of cellular process
GO:0006915	0.698	apoptotic process
GO:0048583	0.616	regulation of response to stimulus
GO:0048519	0.454	negative regulation of biological process
GO:0002684	0.383	positive regulation of immune system process
GO:0032501	0.380	multicellular organismal process
GO:0042127	0.359	regulation of cell population proliferation
GO:0051239	0.355	regulation of multicellular organismal process
GO:0019222	0.355	regulation of metabolic process
GO:0048523	0.342	negative regulation of cellular process
GO:0051240	0.315	positive regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0032991	0.989	protein-containing complex
GO:0098796	0.839	membrane protein complex
GO:0043235	0.833	receptor complex
GO:0098797	0.788	plasma membrane protein complex
GO:0098802	0.783	plasma membrane signaling receptor complex
GO:0005622	0.691	intracellular anatomical structure
GO:0005737	0.599	cytoplasm
GO:0043231	0.452	intracellular membrane-bounded organelle
GO:0009986	0.407	cell surface
GO:0005893	0.366	interleukin-2 receptor complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]