StarFunc result for job id P01730

User Input

>input (458 residues)
MNRGVPFRHLLLVLQLALLPAATQGKKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIK
ILGNQGSFLTKGPSKLNDRADSRRSLWDQGNFPLIIKNLKIEDSDTYICEVEDQKEEVQL
LVFGLTANSDTHLLQGQSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLELQDSG
TWTCTVLQNQKKVEFKIDIVVLAFQKASSIVYKKEGEQVEFSFPLAFTVEKLTGSGELWW
QAERASSSKSWITFDLKNKEVSVKRVTQDPKLQMGKKLPLHLTLPQALPQYAGSGNLTLA
LEAKTGKLHQEVNLVVMRATQLQKNLTCEVWGPTSPKLMLSLKLENKEAKVSKREKAVWV
LNPEAGMWQCLLSDSGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCV
RCRHRRRQAERMSQIKRLLSEKKTCQCPHRFQKTCSPI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P01730	1.000	1.000	1.746E-84	458	1.000	1.000	P01730.pdb.gz	CD4_HUMAN T-cell surface glycoprotein CD4 OS=Homo sapiens OX=9606 GN=CD4 PE=1 SV=1
2	AFDB:P06332	0.810	0.811	3.957E-58	457	0.550	0.551	P06332.pdb.gz	CD4_MOUSE T-cell surface glycoprotein CD4 OS=Mus musculus OX=10090 GN=Cd4 PE=1 SV=1
3	AFDB:P05540	0.785	0.786	1.360E-57	457	0.546	0.547	P05540.pdb.gz	CD4_RAT T-cell surface glycoprotein CD4 OS=Rattus norvegicus OX=10116 GN=Cd4 PE=1 SV=1
4	AFDB:Q1W648	0.472	0.461	5.736E-24	471	0.183	0.178	Q1W648.pdb.gz	Q1W648_ICTPU CD4-1 molecule isoform X1 OS=Ictalurus punctatus OX=7998 GN=cd4-1 PE=4 SV=1
5	AFDB:U5IJK6	0.533	0.516	3.393E-23	476	0.197	0.189	U5IJK6.pdb.gz
6	AFDB:Q61790	0.365	0.329	1.110E-22	521	0.201	0.177	Q61790.pdb.gz	LAG3_MOUSE Lymphocyte activation gene 3 protein OS=Mus musculus OX=10090 GN=Lag3 PE=1 SV=1
7	AFDB:P18627	0.527	0.472	3.349E-21	525	0.183	0.160	P18627.pdb.gz	LAG3_HUMAN Lymphocyte activation gene 3 protein OS=Homo sapiens OX=9606 GN=LAG3 PE=1 SV=5
8	AFDB:A0A0R4IT56	0.296	0.256	4.080E-21	537	0.166	0.142	A0A0R4IT56.pdb.gz
9	AFDB:Q1W649	0.483	0.529	8.991E-21	412	0.162	0.180	Q1W649.pdb.gz	Q1W649_ICTPU CD4-2 molecule, tandem duplicate 2 precursor OS=Ictalurus punctatus OX=7998 GN=cd4-2.2 PE=4 SV=1
10	AFDB:Q01965	0.282	0.212	7.284E-19	654	0.172	0.121	Q01965.pdb.gz	LY9_MOUSE T-lymphocyte surface antigen Ly-9 OS=Mus musculus OX=10090 GN=Ly9 PE=1 SV=2
11	PDB:1e07A	0.223	0.175	5.302E-13	642	0.116	0.083	1e07A.pdb.gz
12	PDB:6dldD	0.222	0.325	7.261E-12	269	0.107	0.182	6dldD.pdb.gz
13	PDB:6dlfA	0.206	0.359	5.499E-11	236	0.090	0.174	6dlfA.pdb.gz
14	PDB:5oj2B	0.177	0.129	1.712E-10	692	0.131	0.087	5oj2B.pdb.gz
15	PDB:7sqcO0	0.187	0.096	2.805E-10	1140	0.085	0.034	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
16	PDB:1zvoC	0.177	0.161	5.073E-10	512	0.151	0.135	1zvoC.pdb.gz
17	PDB:1hzhH	0.186	0.186	3.656E-9	457	0.107	0.107	1hzhH.pdb.gz	Crystal structure of a neutralizing human IGG against HIV-1: a template for vaccine design.
18	PDB:1igaA	0.191	0.185	8.893E-9	475	0.107	0.103	1igaA.pdb.gz
19	PDB:2rcjC	0.182	0.161	8.893E-9	523	0.122	0.107	2rcjC.pdb.gz
20	PDB:4aq1A	0.187	0.141	1.531E-8	721	0.094	0.060	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P01730	0.0	931	458	1.000	1.000	CD4_HUMAN T-cell surface glycoprotein CD4 OS=Homo sapiens OX=9606 GN=CD4 PE=1 SV=1
2	P05540	3.02e-157	455	457	0.537	0.538	CD4_RAT T-cell surface glycoprotein CD4 OS=Rattus norvegicus OX=10116 GN=Cd4 PE=1 SV=1
3	P06332	1.16e-155	451	457	0.533	0.534	CD4_MOUSE T-cell surface glycoprotein CD4 OS=Mus musculus OX=10090 GN=Cd4 PE=1 SV=1
4	P29534	4.17e-05	48.5	739	0.092	0.057	VCAM1_RAT Vascular cell adhesion protein 1 OS=Rattus norvegicus OX=10116 GN=Vcam1 PE=1 SV=1
5	Q92626	5.76e-05	48.1	1479	0.120	0.037	PXDN_HUMAN Peroxidasin homolog OS=Homo sapiens OX=9606 GN=PXDN PE=1 SV=2
6	Q1ERP8	3.50e-04	45.1	331	0.087	0.121	CLM9_MOUSE CMRF35-like molecule 9 OS=Mus musculus OX=10090 GN=Cd300lg PE=1 SV=1
7	Q05695	5.70e-04	45.1	1259	0.100	0.037	L1CAM_RAT Neural cell adhesion molecule L1 OS=Rattus norvegicus OX=10116 GN=L1cam PE=1 SV=3
8	A4IJ70	5.83e-04	44.7	467	0.083	0.081	A4IJ70_DROME Dpr-interacting protein epsilon OS=Drosophila melanogaster OX=7227 GN=DIP-epsilon PE=1 SV=1
9	P11627	0.001	43.9	1260	0.098	0.036	L1CAM_MOUSE Neural cell adhesion molecule L1 OS=Mus musculus OX=10090 GN=L1cam PE=1 SV=1
10	Q0PMG2	0.001	43.5	956	0.105	0.050	MDGA1_MOUSE MAM domain-containing glycosylphosphatidylinositol anchor protein 1 OS=Mus musculus OX=10090 GN=Mdga1 PE=2 SV=3
11	E7F3V2	0.002	43.5	4212	0.114	0.012	E7F3V2_DANRE Hemicentin 2 OS=Danio rerio OX=7955 GN=hmcn2 PE=1 SV=2
12	P85171	0.002	43.1	956	0.107	0.051	MDGA1_RAT MAM domain-containing glycosylphosphatidylinositol anchor protein 1 OS=Rattus norvegicus OX=10116 GN=Mdga1 PE=1 SV=1
13	Q925P2	0.002	43.1	520	0.205	0.181	CEAM2_MOUSE Carcinoembryonic antigen-related cell adhesion molecule 2 OS=Mus musculus OX=10090 GN=Ceacam2 PE=1 SV=3
14	Q8NFP4	0.003	42.7	955	0.103	0.049	MDGA1_HUMAN MAM domain-containing glycosylphosphatidylinositol anchor protein 1 OS=Homo sapiens OX=9606 GN=MDGA1 PE=1 SV=1
15	A0A3B3IU48	0.004	42.4	973	0.105	0.049	A0A3B3IU48_HUMAN MAM domain containing glycosylphosphatidylinositol anchor 1 OS=Homo sapiens OX=9606 GN=MDGA1 PE=1 SV=1
16	P70211	0.006	41.6	1447	0.118	0.037	DCC_MOUSE Netrin receptor DCC OS=Mus musculus OX=10090 GN=Dcc PE=1 SV=2
17	P29533	0.007	41.2	739	0.079	0.049	VCAM1_MOUSE Vascular cell adhesion protein 1 OS=Mus musculus OX=10090 GN=Vcam1 PE=1 SV=1
18	Q63155	0.007	41.6	1445	0.118	0.037	DCC_RAT Netrin receptor DCC OS=Rattus norvegicus OX=10116 GN=Dcc PE=1 SV=2
19	P19320	0.009	41.2	739	0.079	0.049	VCAM1_HUMAN Vascular cell adhesion protein 1 OS=Homo sapiens OX=9606 GN=VCAM1 PE=1 SV=1
20	M9MSH3	0.010	40.8	512	0.096	0.086	M9MSH3_DROME Dpr-interacting protein zeta, isoform C OS=Drosophila melanogaster OX=7227 GN=DIP-zeta PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05790 C2-set	9.6e-37	136.4	Immunoglobulin C2-set domain
2	PF09191 CD4-extracel	5.6e-43	157.1	CD4, extracellular
3	PF07679 I-set	7.1e-09	46.9	Immunoglobulin I-set domain
4	PF00047 ig	3.7e-20	83.2	Immunoglobulin domain
5	PF13895 Ig_2	1.3e-07	43.2	Immunoglobulin domain
6	PF13927 Ig_3	1.5e-07	43.2	Immunoglobulin domain
7	PF16681 Ig_5	2.6	19.9	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
8	PF18452 Ig_6	92	14.3	Immunoglobulin domain
9	PF16706 Izumo-Ig	13	17.1	Izumo-like Immunoglobulin domain
10	PF11465 Receptor_2B4	0.0088	27.6	Natural killer cell receptor 2B4
11	PF12104 Tcell_CD4_C	0.047	25.5	T cell CD4 receptor C terminal region
12	PF10577 UPF0560	1e+02	12.9	Uncharacterised protein family UPF0560
13	PF07686 V-set	1.9e-09	49.0	Immunoglobulin V-set domain
14	PF08204 V-set_CD47	42	15.6	CD47 immunoglobulin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000011653

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000292303	0.999	C-C chemokine receptor type 5
2	9606.ENSP00000337825	0.999	Tyrosine-protein kinase Lck
3	9606.ENSP00000386884	0.999	C-X-C chemokine receptor type 4
4	9606.ENSP00000302935	0.998	Pro-interleukin-16
5	9606.ENSP00000359206	0.997	F-box/WD repeat-containing protein 1A
6	9606.ENSP00000324890	0.996	T-cell-specific surface glycoprotein CD28
7	9606.ENSP00000332049	0.995	T-lymphocyte activation antigen CD86
8	9606.ENSP00000411355	0.995	Receptor-type tyrosine-protein phosphatase C
9	9606.ENSP00000264246	0.994	T-lymphocyte activation antigen CD80
10	9606.ENSP00000386559	0.994	T-cell surface glycoprotein CD8 alpha chain
11	9606.ENSP00000264972	0.991	Tyrosine-protein kinase ZAP-70
12	9606.ENSP00000346671	0.991	Tyrosine-protein kinase Fyn
13	9606.ENSP00000378786	0.991	HLA class II histocompatibility antigen, DR alpha chain
14	9606.ENSP00000266041	0.990	Inter-alpha-trypsin inhibitor heavy chain H4
15	9606.ENSP00000419945	0.990	Syncytin-1
16	9606.ENSP00000265162	0.989	Glutamyl aminopeptidase
17	9606.ENSP00000354782	0.989	T-cell surface glycoprotein CD3 zeta chain
18	9606.ENSP00000046794	0.988	Lymphocyte cytosolic protein 2
19	9606.ENSP00000263645	0.988	CD81 antigen
20	9606.ENSP00000361359	0.988	Tumor necrosis factor receptor superfamily member 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0005102	0.990	signaling receptor binding
GO:0044877	0.978	protein-containing complex binding
GO:0019901	0.945	protein kinase binding
GO:1990782	0.939	protein tyrosine kinase binding
GO:0042287	0.887	MHC protein binding
GO:0042802	0.819	identical protein binding
GO:0140375	0.802	immune receptor activity
GO:0004896	0.754	cytokine receptor activity
GO:0008270	0.744	zinc ion binding
GO:0046983	0.742	protein dimerization activity
GO:0019955	0.737	cytokine binding
GO:0042289	0.432	MHC class II protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.997	response to stimulus
GO:0009987	0.997	cellular process
GO:0050794	0.997	regulation of cellular process
GO:0019222	0.995	regulation of metabolic process
GO:0009893	0.993	positive regulation of metabolic process
GO:0007154	0.983	cell communication
GO:0051716	0.980	cellular response to stimulus
GO:0048522	0.977	positive regulation of cellular process
GO:0060255	0.976	regulation of macromolecule metabolic process
GO:0023052	0.975	signaling
GO:0048583	0.972	regulation of response to stimulus
GO:0007165	0.972	signal transduction
GO:0042110	0.967	T cell activation
GO:0002684	0.961	positive regulation of immune system process
GO:0050863	0.959	regulation of T cell activation
GO:0010033	0.938	response to organic substance
GO:0051240	0.935	positive regulation of multicellular organismal process
GO:0010604	0.935	positive regulation of macromolecule metabolic process
GO:0048584	0.925	positive regulation of response to stimulus
GO:0023051	0.914	regulation of signaling
GO:0051171	0.914	regulation of nitrogen compound metabolic process
GO:0010646	0.914	regulation of cell communication
GO:0080090	0.912	regulation of primary metabolic process
GO:0031323	0.912	regulation of cellular metabolic process
GO:0010468	0.907	regulation of gene expression
GO:0009966	0.903	regulation of signal transduction
GO:0007166	0.897	cell surface receptor signaling pathway
GO:1902533	0.893	positive regulation of intracellular signal transduction
GO:0051173	0.875	positive regulation of nitrogen compound metabolic process
GO:0051246	0.874	regulation of protein metabolic process
GO:0031325	0.874	positive regulation of cellular metabolic process
GO:0051174	0.872	regulation of phosphorus metabolic process
GO:0045937	0.860	positive regulation of phosphate metabolic process
GO:0042325	0.859	regulation of phosphorylation
GO:0051247	0.856	positive regulation of protein metabolic process
GO:0042327	0.854	positive regulation of phosphorylation
GO:0001932	0.853	regulation of protein phosphorylation
GO:0022407	0.848	regulation of cell-cell adhesion
GO:0031401	0.843	positive regulation of protein modification process
GO:0048856	0.841	anatomical structure development
GO:0032879	0.782	regulation of localization
GO:1903037	0.761	regulation of leukocyte cell-cell adhesion
GO:0045785	0.759	positive regulation of cell adhesion
GO:0001934	0.757	positive regulation of protein phosphorylation
GO:0051049	0.747	regulation of transport
GO:0050792	0.745	regulation of viral process
GO:1903039	0.711	positive regulation of leukocyte cell-cell adhesion
GO:0051251	0.708	positive regulation of lymphocyte activation
GO:1903900	0.699	regulation of viral life cycle
GO:0043903	0.674	regulation of biological process involved in symbiotic interaction
GO:0010959	0.671	regulation of metal ion transport
GO:0051050	0.670	positive regulation of transport
GO:0052372	0.650	modulation by symbiont of entry into host
GO:0046596	0.608	regulation of viral entry into host cell
GO:0065009	0.589	regulation of molecular function
GO:0009889	0.585	regulation of biosynthetic process
GO:0070887	0.562	cellular response to chemical stimulus
GO:0008152	0.560	metabolic process
GO:0071310	0.542	cellular response to organic substance
GO:0030154	0.541	cell differentiation
GO:0051924	0.538	regulation of calcium ion transport
GO:0050793	0.535	regulation of developmental process
GO:0051179	0.529	localization
GO:0031326	0.524	regulation of cellular biosynthetic process
GO:0019219	0.524	regulation of nucleobase-containing compound metabolic process
GO:0006950	0.514	response to stress
GO:0006355	0.490	regulation of DNA-templated transcription
GO:0043408	0.473	regulation of MAPK cascade
GO:0009605	0.461	response to external stimulus
GO:0044093	0.453	positive regulation of molecular function
GO:0071704	0.451	organic substance metabolic process
GO:0045597	0.451	positive regulation of cell differentiation
GO:0060284	0.450	regulation of cell development
GO:0048468	0.449	cell development
GO:0050790	0.445	regulation of catalytic activity
GO:0048519	0.441	negative regulation of biological process
GO:0044238	0.432	primary metabolic process
GO:0042127	0.430	regulation of cell population proliferation
GO:2000026	0.422	regulation of multicellular organismal development
GO:0044419	0.409	biological process involved in interspecies interaction between organisms
GO:0071345	0.387	cellular response to cytokine stimulus
GO:0002521	0.383	leukocyte differentiation
GO:1902105	0.380	regulation of leukocyte differentiation
GO:0010628	0.376	positive regulation of gene expression
GO:0050776	0.375	regulation of immune response
GO:0019221	0.374	cytokine-mediated signaling pathway
GO:0070372	0.372	regulation of ERK1 and ERK2 cascade
GO:0045637	0.372	regulation of myeloid cell differentiation
GO:0048523	0.371	negative regulation of cellular process
GO:0043549	0.367	regulation of kinase activity
GO:0043085	0.366	positive regulation of catalytic activity
GO:0002761	0.362	regulation of myeloid leukocyte differentiation
GO:0051347	0.357	positive regulation of transferase activity
GO:0051641	0.356	cellular localization
GO:0033036	0.355	macromolecule localization
GO:0044237	0.355	cellular metabolic process
GO:0045859	0.354	regulation of protein kinase activity
GO:0010720	0.353	positive regulation of cell development
GO:0043410	0.349	positive regulation of MAPK cascade
GO:0006807	0.347	nitrogen compound metabolic process
GO:0031328	0.344	positive regulation of cellular biosynthetic process
GO:0051254	0.312	positive regulation of RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009986	1.000	cell surface
GO:0005886	1.000	plasma membrane
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0098552	0.997	side of membrane
GO:0012505	0.996	endomembrane system
GO:0009897	0.994	external side of plasma membrane
GO:0031090	0.963	organelle membrane
GO:0005783	0.779	endoplasmic reticulum
GO:0031982	0.726	vesicle
GO:0070013	0.715	intracellular organelle lumen
GO:0031410	0.701	cytoplasmic vesicle
GO:0031984	0.694	organelle subcompartment
GO:0098588	0.687	bounding membrane of organelle
GO:0005768	0.579	endosome
GO:0042175	0.567	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0098827	0.566	endoplasmic reticulum subcompartment
GO:0005789	0.553	endoplasmic reticulum membrane
GO:0030659	0.537	cytoplasmic vesicle membrane
GO:0045121	0.495	membrane raft
GO:0030139	0.428	endocytic vesicle
GO:0031981	0.413	nuclear lumen
GO:0098576	0.385	lumenal side of membrane
GO:0098553	0.379	lumenal side of endoplasmic reticulum membrane
GO:0005654	0.347	nucleoplasm
GO:0005576	0.341	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]