StarFunc result for job id P01859

User Input

>input (326 residues)
ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
GLYSLSSVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVF
LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFR
VVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKN
QVSLTCLVKGFYPSDISVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGN
VFSCSVMHEALHNHYTQKSLSLSPGK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P01857	0.870	0.860	4.657E-56	330	0.920	0.909	P01857.pdb.gz	IGHG1_HUMAN Immunoglobulin heavy constant gamma 1 OS=Homo sapiens OX=9606 GN=IGHG1 PE=1 SV=2
2	AFDB:P01860	0.651	0.564	3.920E-55	377	0.929	0.804	P01860.pdb.gz	IGHG3_HUMAN Immunoglobulin heavy constant gamma 3 OS=Homo sapiens OX=9606 GN=IGHG3 PE=1 SV=3
3	PDB:1hzhH	0.734	0.553	8.043E-51	457	0.917	0.654	1hzhH.pdb.gz	Crystal structure of a neutralizing human IGG against HIV-1: a template for vaccine design.
4	AFDB:P01870	0.739	0.745	4.304E-47	323	0.684	0.690	P01870.pdb.gz	IGHG_RABIT Ig gamma chain C region OS=Oryctolagus cuniculus OX=9986 PE=1 SV=1
5	PDB:2rcjC	0.620	0.389	2.221E-45	523	0.865	0.539	2rcjC.pdb.gz
6	AFDB:P01869	0.644	0.535	7.449E-44	393	0.635	0.527	P01869.pdb.gz	IGH1M_MOUSE Ig gamma-1 chain C region, membrane-bound form OS=Mus musculus OX=10090 GN=Ighg1 PE=1 SV=2
7	AFDB:P01865	0.636	0.524	9.599E-44	398	0.632	0.518	P01865.pdb.gz	GCAM_MOUSE Ig gamma-2A chain C region, membrane-bound form OS=Mus musculus OX=10090 GN=Igh-1a PE=1 SV=3
8	AFDB:P03987	0.629	0.518	6.940E-43	398	0.632	0.518	P03987.pdb.gz	IGHG3_MOUSE Ig gamma-3 chain C region OS=Mus musculus OX=10090 PE=1 SV=2
9	AFDB:P01867	0.650	0.527	1.356E-40	404	0.610	0.493	P01867.pdb.gz	IGG2B_MOUSE Immunoglobulin heavy constant gamma 2B OS=Mus musculus OX=10090 GN=Ighg2b PE=1 SV=3
10	PDB:1igtB	0.653	0.488	1.625E-37	444	0.626	0.459	1igtB.pdb.gz	Refined structure of an intact IgG2a monoclonal antibody.
11	AFDB:P01876	0.564	0.523	9.258E-27	353	0.347	0.320	P01876.pdb.gz	IGHA1_HUMAN Immunoglobulin heavy constant alpha 1 OS=Homo sapiens OX=9606 GN=IGHA1 PE=1 SV=3
12	AFDB:P04221	0.583	0.404	5.194E-26	479	0.340	0.232	P04221.pdb.gz	MUCM_RABIT Ig mu chain C region membrane-bound form OS=Oryctolagus cuniculus OX=9986 PE=2 SV=2
13	AFDB:P01878	0.588	0.559	6.694E-26	344	0.304	0.288	P01878.pdb.gz	IGHA_MOUSE Ig alpha chain C region OS=Mus musculus OX=10090 PE=1 SV=1
14	PDB:1zvoC	0.558	0.364	3.673E-22	512	0.276	0.176	1zvoC.pdb.gz
15	PDB:1igaA	0.460	0.335	1.013E-21	475	0.328	0.225	1igaA.pdb.gz
16	PDB:7jg1A	0.554	0.757	5.039E-15	231	0.193	0.273	7jg1A.pdb.gz
17	PDB:1ngwH	0.304	0.456	2.582E-12	216	0.273	0.412	1ngwH.pdb.gz	Structural evidence for substrate strain in antibody catalysis
18	PDB:2ig2H	0.312	0.423	1.603E-11	238	0.291	0.399	2ig2H.pdb.gz
19	PDB:6mp0A	0.275	0.235	2.287E-11	388	0.184	0.155	6mp0A.pdb.gz
20	PDB:6d7gA	0.292	0.252	4.651E-11	386	0.160	0.135	6d7gA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P01857	0.0	587	330	0.920	0.909	IGHG1_HUMAN Immunoglobulin heavy constant gamma 1 OS=Homo sapiens OX=9606 GN=IGHG1 PE=1 SV=2
2	P01859	0.0	669	326	1.000	1.000	IGHG2_HUMAN Immunoglobulin heavy constant gamma 2 OS=Homo sapiens OX=9606 GN=IGHG2 PE=1 SV=3
3	P01860	0.0	552	377	0.923	0.798	IGHG3_HUMAN Immunoglobulin heavy constant gamma 3 OS=Homo sapiens OX=9606 GN=IGHG3 PE=1 SV=3
4	P01861	0.0	588	327	0.923	0.920	IGHG4_HUMAN Immunoglobulin heavy constant gamma 4 OS=Homo sapiens OX=9606 GN=IGHG4 PE=1 SV=2
5	P01870	2.46e-155	439	323	0.687	0.693	IGHG_RABIT Ig gamma chain C region OS=Oryctolagus cuniculus OX=9986 PE=1 SV=1
6	P01868	8.43e-147	418	324	0.641	0.645	IGHG1_MOUSE Ig gamma-1 chain C region secreted form OS=Mus musculus OX=10090 GN=Ighg1 PE=1 SV=1
7	A0A075B5P5	6.61e-146	416	330	0.638	0.630	A0A075B5P5_MOUSE Immunoglobulin heavy constant gamma 3 (Fragment) OS=Mus musculus OX=10090 GN=Ighg3 PE=4 SV=1
8	P01869	1.49e-145	417	393	0.638	0.529	IGH1M_MOUSE Ig gamma-1 chain C region, membrane-bound form OS=Mus musculus OX=10090 GN=Ighg1 PE=1 SV=2
9	A0A0A6YY53	4.19e-145	414	335	0.620	0.603	A0A0A6YY53_MOUSE Immunoglobulin heavy constant gamma 2C (Fragment) OS=Mus musculus OX=10090 GN=Ighg2c PE=1 SV=1
10	P03987	5.29e-144	414	398	0.632	0.518	IGHG3_MOUSE Ig gamma-3 chain C region OS=Mus musculus OX=10090 PE=1 SV=2
11	A0A1Y7VJN6	9.45e-144	413	399	0.632	0.516	A0A1Y7VJN6_MOUSE Immunoglobulin heavy constant gamma 3 (Fragment) OS=Mus musculus OX=10090 GN=Ighg3 PE=4 SV=1
12	F6TQW2	1.07e-143	413	404	0.617	0.498	F6TQW2_MOUSE Immunoglobulin heavy constant gamma 2C (Fragment) OS=Mus musculus OX=10090 GN=Ighg2c PE=1 SV=2
13	P01863	6.62e-135	388	330	0.623	0.615	GCAA_MOUSE Ig gamma-2A chain C region, A allele OS=Mus musculus OX=10090 GN=Ighg PE=1 SV=1
14	P01865	4.33e-133	386	398	0.617	0.505	GCAM_MOUSE Ig gamma-2A chain C region, membrane-bound form OS=Mus musculus OX=10090 GN=Igh-1a PE=1 SV=3
15	P01867	2.96e-131	381	404	0.613	0.495	IGG2B_MOUSE Immunoglobulin heavy constant gamma 2B OS=Mus musculus OX=10090 GN=Ighg2b PE=1 SV=3
16	Q6KAM2	7.95e-107	315	303	0.451	0.485	Q6KAM2_MOUSE MFLJ00385 protein (Fragment) OS=Mus musculus OX=10090 GN=Ighg3 PE=2 SV=1
17	P04221	3.99e-43	156	479	0.307	0.209	MUCM_RABIT Ig mu chain C region membrane-bound form OS=Oryctolagus cuniculus OX=9986 PE=2 SV=2
18	P01872	6.15e-43	155	454	0.322	0.231	IGHM_MOUSE Immunoglobulin heavy constant mu OS=Mus musculus OX=10090 GN=Ighm PE=1 SV=2
19	P01871	2.35e-42	154	453	0.310	0.223	IGHM_HUMAN Immunoglobulin heavy constant mu OS=Homo sapiens OX=9606 GN=IGHM PE=1 SV=5
20	P01854	6.70e-42	152	428	0.298	0.227	IGHE_HUMAN Immunoglobulin heavy constant epsilon OS=Homo sapiens OX=9606 GN=IGHE PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	2.1e-68	238.0	Immunoglobulin C1-set domain
2	PF08205 C2-set_2	1.3e-14	65.3	CD80-like C2-set immunoglobulin domain
3	PF07679 I-set	0.27	22.7	Immunoglobulin I-set domain
4	PF00047 ig	1.4e-06	39.7	Immunoglobulin domain
5	PF13927 Ig_3	1e-10	53.3	Immunoglobulin domain
6	PF02124 Marek_A	7.5	18.3	Marek's disease glycoprotein A

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000007070

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000007289	0.931	Beta-2-microglobulin
2	9601.ENSPPYP00000002024	0.843	Complement component 1, q subcomponent, B chain
3	9601.ENSPPYP00000002025	0.843	Complement component 1, q subcomponent, C chain
4	9601.ENSPPYP00000018622	0.800	Vascular endothelial growth factor A
5	9601.ENSPPYP00000000694	0.730	Uncharacterized protein
6	9601.ENSPPYP00000011477	0.617	Uncharacterized protein
7	9601.ENSPPYP00000012953	0.588	Zinc finger protein 280B
8	9601.ENSPPYP00000020857	0.563	LYN proto-oncogene, Src family tyrosine kinase
9	9601.ENSPPYP00000000769	0.533	Fc fragment of IgE, high affinity I, receptor for
10	9601.ENSPPYP00000001917	0.519	FGR proto-oncogene, Src family tyrosine kinase
11	9601.ENSPPYP00000008163	0.519	Linker for activation of T cells
12	9601.ENSPPYP00000012176	0.519	HCK proto-oncogene, Src family tyrosine kinase
13	9601.ENSPPYP00000018422	0.516	Uncharacterized protein
14	9601.ENSPPYP00000013104	0.514	Solute carrier family 5 (glucose activated ion channel), member 4
15	9601.ENSPPYP00000007352	0.509	Myosin VA (heavy chain 12, myoxin)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0034987	0.997	immunoglobulin receptor binding
GO:0003823	0.979	antigen binding
GO:0044877	0.462	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006955	0.996	immune response
GO:0002250	0.994	adaptive immune response
GO:0009987	0.980	cellular process
GO:0006952	0.980	defense response
GO:0006954	0.938	inflammatory response
GO:0002460	0.935	adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0016064	0.927	immunoglobulin mediated immune response
GO:0001906	0.908	cell killing
GO:0002437	0.828	inflammatory response to antigenic stimulus
GO:0002444	0.816	myeloid leukocyte mediated immunity
GO:0002526	0.760	acute inflammatory response
GO:0001909	0.755	leukocyte mediated cytotoxicity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070062	0.998	extracellular exosome
GO:0072562	0.990	blood microparticle
GO:0032991	0.820	protein-containing complex
GO:0016020	0.674	membrane
GO:0071944	0.392	cell periphery
GO:0005886	0.375	plasma membrane
GO:0019814	0.330	immunoglobulin complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]