StarFunc result for job id P01861

User Input

>input (327 residues)
ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
GLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPSCPAPEFLGGPSV
FLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTY
RVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTK
NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEG
NVFSCSVMHEALHNHYTQKSLSLSLGK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P01860	0.679	0.595	1.628E-55	377	0.914	0.793	P01860.pdb.gz	IGHG3_HUMAN Immunoglobulin heavy constant gamma 3 OS=Homo sapiens OX=9606 GN=IGHG3 PE=1 SV=3
2	AFDB:P01857	0.649	0.643	3.348E-54	330	0.914	0.906	P01857.pdb.gz	IGHG1_HUMAN Immunoglobulin heavy constant gamma 1 OS=Homo sapiens OX=9606 GN=IGHG1 PE=1 SV=2
3	PDB:1hzhH	0.639	0.460	4.142E-50	457	0.911	0.652	1hzhH.pdb.gz	Crystal structure of a neutralizing human IGG against HIV-1: a template for vaccine design.
4	AFDB:P01870	0.650	0.658	2.402E-46	323	0.688	0.697	P01870.pdb.gz	IGHG_RABIT Ig gamma chain C region OS=Oryctolagus cuniculus OX=9986 PE=1 SV=1
5	PDB:2rcjC	0.619	0.394	3.801E-45	523	0.872	0.545	2rcjC.pdb.gz
6	AFDB:P03987	0.711	0.595	1.525E-44	398	0.618	0.508	P03987.pdb.gz	IGHG3_MOUSE Ig gamma-3 chain C region OS=Mus musculus OX=10090 PE=1 SV=2
7	AFDB:P01865	0.668	0.557	2.545E-44	398	0.633	0.520	P01865.pdb.gz	GCAM_MOUSE Ig gamma-2A chain C region, membrane-bound form OS=Mus musculus OX=10090 GN=Igh-1a PE=1 SV=3
8	AFDB:P01869	0.641	0.534	1.312E-43	393	0.621	0.517	P01869.pdb.gz	IGH1M_MOUSE Ig gamma-1 chain C region, membrane-bound form OS=Mus musculus OX=10090 GN=Ighg1 PE=1 SV=2
9	AFDB:P01867	0.666	0.542	4.755E-41	404	0.602	0.488	P01867.pdb.gz	IGG2B_MOUSE Immunoglobulin heavy constant gamma 2B OS=Mus musculus OX=10090 GN=Ighg2b PE=1 SV=3
10	PDB:1igtB	0.623	0.461	5.863E-38	444	0.630	0.464	1igtB.pdb.gz	Refined structure of an intact IgG2a monoclonal antibody.
11	AFDB:P01876	0.570	0.531	2.318E-26	353	0.349	0.323	P01876.pdb.gz	IGHA1_HUMAN Immunoglobulin heavy constant alpha 1 OS=Homo sapiens OX=9606 GN=IGHA1 PE=1 SV=3
12	AFDB:P01878	0.563	0.537	1.625E-25	344	0.309	0.294	P01878.pdb.gz	IGHA_MOUSE Ig alpha chain C region OS=Mus musculus OX=10090 PE=1 SV=1
13	AFDB:P04221	0.580	0.404	2.099E-25	479	0.324	0.221	P04221.pdb.gz	MUCM_RABIT Ig mu chain C region membrane-bound form OS=Oryctolagus cuniculus OX=9986 PE=2 SV=2
14	PDB:1igaA	0.445	0.328	2.116E-21	475	0.333	0.229	1igaA.pdb.gz
15	PDB:1zvoC	0.549	0.361	2.467E-21	512	0.257	0.164	1zvoC.pdb.gz
16	PDB:7jg1A	0.542	0.740	5.429E-15	231	0.202	0.286	7jg1A.pdb.gz
17	PDB:1ngwH	0.296	0.446	4.244E-12	216	0.272	0.412	1ngwH.pdb.gz	Structural evidence for substrate strain in antibody catalysis
18	PDB:2jb5L	0.297	0.451	4.482E-11	211	0.122	0.190	2jb5L.pdb.gz	Fab Mor03268 Triggers Absorption Shift of a Diagnostic Dye Via Packaging in a Solvent-Shielded Fab Dimer Interface
19	PDB:4o5lL	0.301	0.450	6.754E-11	215	0.141	0.214	4o5lL.pdb.gz
20	PDB:2ig2H	0.309	0.421	7.482E-11	238	0.287	0.395	2ig2H.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P01857	0.0	583	330	0.917	0.909	IGHG1_HUMAN Immunoglobulin heavy constant gamma 1 OS=Homo sapiens OX=9606 GN=IGHG1 PE=1 SV=2
2	P01859	0.0	590	326	0.917	0.920	IGHG2_HUMAN Immunoglobulin heavy constant gamma 2 OS=Homo sapiens OX=9606 GN=IGHG2 PE=1 SV=3
3	P01860	0.0	557	377	0.908	0.788	IGHG3_HUMAN Immunoglobulin heavy constant gamma 3 OS=Homo sapiens OX=9606 GN=IGHG3 PE=1 SV=3
4	P01861	0.0	669	327	1.000	1.000	IGHG4_HUMAN Immunoglobulin heavy constant gamma 4 OS=Homo sapiens OX=9606 GN=IGHG4 PE=1 SV=2
5	P01870	6.62e-155	438	323	0.679	0.687	IGHG_RABIT Ig gamma chain C region OS=Oryctolagus cuniculus OX=9986 PE=1 SV=1
6	A0A0A6YY53	2.28e-148	422	335	0.627	0.612	A0A0A6YY53_MOUSE Immunoglobulin heavy constant gamma 2C (Fragment) OS=Mus musculus OX=10090 GN=Ighg2c PE=1 SV=1
7	A0A075B5P5	6.40e-147	418	330	0.624	0.618	A0A075B5P5_MOUSE Immunoglobulin heavy constant gamma 3 (Fragment) OS=Mus musculus OX=10090 GN=Ighg3 PE=4 SV=1
8	F6TQW2	7.65e-147	421	404	0.624	0.505	F6TQW2_MOUSE Immunoglobulin heavy constant gamma 2C (Fragment) OS=Mus musculus OX=10090 GN=Ighg2c PE=1 SV=2
9	P03987	1.39e-145	417	398	0.618	0.508	IGHG3_MOUSE Ig gamma-3 chain C region OS=Mus musculus OX=10090 PE=1 SV=2
10	A0A1Y7VJN6	2.20e-145	417	399	0.618	0.506	A0A1Y7VJN6_MOUSE Immunoglobulin heavy constant gamma 3 (Fragment) OS=Mus musculus OX=10090 GN=Ighg3 PE=4 SV=1
11	P01868	5.43e-142	405	324	0.624	0.630	IGHG1_MOUSE Ig gamma-1 chain C region secreted form OS=Mus musculus OX=10090 GN=Ighg1 PE=1 SV=1
12	P01869	1.55e-140	404	393	0.621	0.517	IGH1M_MOUSE Ig gamma-1 chain C region, membrane-bound form OS=Mus musculus OX=10090 GN=Ighg1 PE=1 SV=2
13	P01863	8.43e-136	390	330	0.624	0.618	GCAA_MOUSE Ig gamma-2A chain C region, A allele OS=Mus musculus OX=10090 GN=Ighg PE=1 SV=1
14	P01865	9.56e-134	387	398	0.618	0.508	GCAM_MOUSE Ig gamma-2A chain C region, membrane-bound form OS=Mus musculus OX=10090 GN=Igh-1a PE=1 SV=3
15	P01867	1.65e-130	379	404	0.609	0.493	IGG2B_MOUSE Immunoglobulin heavy constant gamma 2B OS=Mus musculus OX=10090 GN=Ighg2b PE=1 SV=3
16	Q6KAM2	2.80e-107	317	303	0.440	0.475	Q6KAM2_MOUSE MFLJ00385 protein (Fragment) OS=Mus musculus OX=10090 GN=Ighg3 PE=2 SV=1
17	P01872	1.02e-40	149	454	0.315	0.227	IGHM_MOUSE Immunoglobulin heavy constant mu OS=Mus musculus OX=10090 GN=Ighm PE=1 SV=2
18	P04221	2.16e-39	146	479	0.294	0.200	MUCM_RABIT Ig mu chain C region membrane-bound form OS=Oryctolagus cuniculus OX=9986 PE=2 SV=2
19	P01871	2.73e-39	145	453	0.300	0.216	IGHM_HUMAN Immunoglobulin heavy constant mu OS=Homo sapiens OX=9606 GN=IGHM PE=1 SV=5
20	P06336	1.04e-38	143	421	0.312	0.242	IGHE_MOUSE Immunoglobulin heavy constant epsilon OS=Mus musculus OX=10090 GN=IGHE PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	9.6e-68	235.9	Immunoglobulin C1-set domain
2	PF08205 C2-set_2	9.3e-14	62.6	CD80-like C2-set immunoglobulin domain
3	PF07679 I-set	0.5	21.8	Immunoglobulin I-set domain
4	PF00047 ig	1e-06	40.1	Immunoglobulin domain
5	PF13927 Ig_3	2.3e-10	52.2	Immunoglobulin domain
6	PF02124 Marek_A	3.5	19.4	Marek's disease glycoprotein A

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9555.ENSPANP00000013139

Rank	PPI partner	STRING score	Description
1	9555.ENSPANP00000013995	0.806	Beta-2-microglobulin
2	9555.ENSPANP00000008958	0.711	Complement component 1, q subcomponent, C chain
3	9555.ENSPANP00000004662	0.708	Complement component 1, q subcomponent, B chain
4	9555.ENSPANP00000012784	0.645	Vascular endothelial growth factor A
5	9555.ENSPANP00000004693	0.636	Fc fragment of IgG, receptor, transporter, alpha
6	9555.ENSPANP00000011014	0.631	Complement component 1, q subcomponent, A chain
7	9555.ENSPANP00000015099	0.577	Fc fragment of IgE, high affinity I, receptor for
8	9555.ENSPANP00000009782	0.546	Papio anubis Fc fragment of IgA, receptor for (FCAR), mRNA
9	9555.ENSPANP00000002078	0.519	annotation not available
10	9555.ENSPANP00000003342	0.519	annotation not available
11	9555.ENSPANP00000003786	0.519	annotation not available
12	9555.ENSPANP00000005416	0.519	annotation not available
13	9555.ENSPANP00000007421	0.519	annotation not available
14	9555.ENSPANP00000008077	0.519	annotation not available
15	9555.ENSPANP00000011388	0.519	annotation not available
16	9555.ENSPANP00000015467	0.519	annotation not available
17	9555.ENSPANP00000000328	0.509	FGR proto-oncogene, Src family tyrosine kinase
18	9555.ENSPANP00000016865	0.509	HCK proto-oncogene, Src family tyrosine kinase
19	9555.ENSPANP00000012450	0.507	Linker for activation of T cells
20	9555.ENSPANP00000004416	0.506	LYN proto-oncogene, Src family tyrosine kinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0034987	0.997	immunoglobulin receptor binding
GO:0003823	0.965	antigen binding
GO:0044877	0.455	protein-containing complex binding
GO:0060089	0.305	molecular transducer activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0002250	0.996	adaptive immune response
GO:0006952	0.980	defense response
GO:0009987	0.976	cellular process
GO:0002460	0.936	adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0016064	0.929	immunoglobulin mediated immune response
GO:0006954	0.882	inflammatory response
GO:0002444	0.841	myeloid leukocyte mediated immunity
GO:0002437	0.769	inflammatory response to antigenic stimulus
GO:0002526	0.762	acute inflammatory response
GO:0001909	0.762	leukocyte mediated cytotoxicity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0031982	0.999	vesicle
GO:0070062	0.991	extracellular exosome
GO:0072562	0.989	blood microparticle
GO:0032991	0.693	protein-containing complex
GO:0019814	0.427	immunoglobulin complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]