StarFunc result for job id P01889

User Input

>input (362 residues)
MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRF
DSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQ
SMYGCDVGPDGRLLRGHDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQR
RAYLEGECVEWLRRYLENGKDKLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
SSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGKGGSYSQAACSDSAQGSDVSL
TA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P01889	1.000	1.000	2.798E-68	362	1.000	1.000	P01889.pdb.gz	HLAB_HUMAN HLA class I histocompatibility antigen, B alpha chain OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=3
2	AFDB:A0A583ZBW8	0.855	0.846	4.124E-61	366	0.876	0.866	A0A583ZBW8.pdb.gz	A0A583ZBW8_HUMAN HLA-C protein OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=1
3	AFDB:P10321	0.877	0.867	2.232E-60	366	0.865	0.855	P10321.pdb.gz	HLAC_HUMAN HLA class I histocompatibility antigen, C alpha chain OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=3
4	AFDB:P01893	0.828	0.828	1.191E-58	362	0.859	0.859	P01893.pdb.gz	HLAH_HUMAN Putative HLA class I histocompatibility antigen, alpha chain H OS=Homo sapiens OX=9606 GN=HLA-H PE=5 SV=3
5	AFDB:P04439	0.884	0.877	1.328E-58	365	0.856	0.849	P04439.pdb.gz	HLAA_HUMAN HLA class I histocompatibility antigen, A alpha chain OS=Homo sapiens OX=9606 GN=HLA-A PE=1 SV=2
6	AFDB:P17693	0.872	0.932	1.814E-57	338	0.754	0.808	P17693.pdb.gz	HLAG_HUMAN HLA class I histocompatibility antigen, alpha chain G OS=Homo sapiens OX=9606 GN=HLA-G PE=1 SV=1
7	AFDB:P30511	0.837	0.874	1.965E-55	346	0.760	0.795	P30511.pdb.gz	HLAF_HUMAN HLA class I histocompatibility antigen, alpha chain F OS=Homo sapiens OX=9606 GN=HLA-F PE=1 SV=3
8	AFDB:P13747	0.773	0.782	5.531E-55	358	0.757	0.765	P13747.pdb.gz	HLAE_HUMAN HLA class I histocompatibility antigen, alpha chain E OS=Homo sapiens OX=9606 GN=HLA-E PE=1 SV=4
9	AFDB:Q95476	0.799	0.815	3.474E-53	355	0.721	0.735	Q95476.pdb.gz	Q95476_BOVIN MHC Class I (Fragment) OS=Bos taurus OX=9913 GN=JSP.1 PE=2 SV=1
10	AFDB:P01902	0.787	0.774	7.053E-53	368	0.674	0.663	P01902.pdb.gz	HA1D_MOUSE H-2 class I histocompatibility antigen, K-D alpha chain OS=Mus musculus OX=10090 GN=H2-K1 PE=1 SV=1
11	PDB:6d7gA	0.746	0.701	1.969E-45	386	0.641	0.601	6d7gA.pdb.gz
12	PDB:6e1iA	0.753	0.702	5.855E-45	389	0.605	0.563	6e1iA.pdb.gz
13	PDB:5j6hA	0.752	0.988	1.009E-44	275	0.583	0.767	5j6hA.pdb.gz	Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
14	PDB:6mp0A	0.735	0.687	5.917E-42	388	0.555	0.518	6mp0A.pdb.gz
15	PDB:2qriA	0.739	0.673	1.005E-40	398	0.544	0.495	2qriA.pdb.gz
16	PDB:3nwmA	0.736	0.695	1.933E-40	384	0.558	0.526	3nwmA.pdb.gz
17	PDB:3es6A	0.623	0.789	7.455E-28	277	0.293	0.383	3es6A.pdb.gz	Crystal structure of the novel complex formed between zinc alpha2-glycoprotein (ZAG) and prolactin-inducible protein (PIP) from human seminal plasma
18	PDB:6fgbA	0.608	0.804	4.482E-23	265	0.210	0.287	6fgbA.pdb.gz
19	PDB:3ov6A	0.598	0.578	1.742E-18	376	0.157	0.152	3ov6A.pdb.gz	The 2.5 A structure of CD1c in complex with a mycobacterial lipid reveals an open groove ideally suited for diverse antigen presentation
20	PDB:1cd1A	0.589	0.751	2.167E-18	273	0.171	0.227	1cd1A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A583ZBW8	0.0	594	366	0.851	0.842	A0A583ZBW8_HUMAN HLA-C protein OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=1
2	P01889	0.0	748	362	1.000	1.000	HLAB_HUMAN HLA class I histocompatibility antigen, B alpha chain OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=3
3	P01893	0.0	606	362	0.859	0.859	HLAH_HUMAN Putative HLA class I histocompatibility antigen, alpha chain H OS=Homo sapiens OX=9606 GN=HLA-H PE=5 SV=3
4	P04439	0.0	621	365	0.856	0.849	HLAA_HUMAN HLA class I histocompatibility antigen, A alpha chain OS=Homo sapiens OX=9606 GN=HLA-A PE=1 SV=2
5	P10321	0.0	573	366	0.843	0.833	HLAC_HUMAN HLA class I histocompatibility antigen, C alpha chain OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=3
6	P13747	0.0	509	358	0.727	0.735	HLAE_HUMAN HLA class I histocompatibility antigen, alpha chain E OS=Homo sapiens OX=9606 GN=HLA-E PE=1 SV=4
7	P17693	0.0	549	338	0.754	0.808	HLAG_HUMAN HLA class I histocompatibility antigen, alpha chain G OS=Homo sapiens OX=9606 GN=HLA-G PE=1 SV=1
8	P30511	0.0	517	346	0.760	0.795	HLAF_HUMAN HLA class I histocompatibility antigen, alpha chain F OS=Homo sapiens OX=9606 GN=HLA-F PE=1 SV=3
9	Q53YP1	0.0	605	366	0.867	0.858	Q53YP1_HUMAN HLA class I histocompatibility antigen OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=1
10	Q5RIP0	0.0	608	366	0.856	0.847	Q5RIP0_HUMAN HLA class I histocompatibility antigen OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=1
11	Q5SUL5	0.0	613	365	0.843	0.836	Q5SUL5_HUMAN HLA class I histocompatibility antigen OS=Homo sapiens OX=9606 GN=HLA-A PE=1 SV=1
12	Q7YQB1	0.0	583	366	0.865	0.855	Q7YQB1_HUMAN MHC class I antigen OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=1
13	Q95476	1.06e-179	504	355	0.696	0.710	Q95476_BOVIN MHC Class I (Fragment) OS=Bos taurus OX=9913 GN=JSP.1 PE=2 SV=1
14	P01897	5.98e-173	487	362	0.696	0.696	HA1L_MOUSE H-2 class I histocompatibility antigen, L-D alpha chain OS=Mus musculus OX=10090 GN=H2-L PE=1 SV=2
15	P01899	9.23e-170	479	362	0.688	0.688	HA11_MOUSE H-2 class I histocompatibility antigen, D-B alpha chain OS=Mus musculus OX=10090 GN=H2-D1 PE=1 SV=2
16	Q4KN81	3.23e-167	473	360	0.646	0.650	Q4KN81_MOUSE Histocompatibility 2, Q region locus 2 OS=Mus musculus OX=10090 GN=H2-Q2 PE=1 SV=1
17	P01902	2.61e-166	471	368	0.677	0.666	HA1D_MOUSE H-2 class I histocompatibility antigen, K-D alpha chain OS=Mus musculus OX=10090 GN=H2-K1 PE=1 SV=1
18	P01900	4.52e-166	470	365	0.671	0.666	HA12_MOUSE H-2 class I histocompatibility antigen, D-D alpha chain OS=Mus musculus OX=10090 GN=H2-D1 PE=1 SV=1
19	P03991	2.18e-165	468	368	0.677	0.666	HA1W_MOUSE H-2 class I histocompatibility antigen, K-W28 alpha chain OS=Mus musculus OX=10090 GN=H2-K1 PE=1 SV=2
20	P14426	3.51e-165	467	362	0.674	0.674	HA13_MOUSE H-2 class I histocompatibility antigen, D-K alpha chain OS=Mus musculus OX=10090 GN=H2-D1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	3.2e-11	54.8	Immunoglobulin C1-set domain
2	PF08205 C2-set_2	3.5	19.1	CD80-like C2-set immunoglobulin domain
3	PF00047 ig	6.8	18.3	Immunoglobulin domain
4	PF13927 Ig_3	0.024	26.5	Immunoglobulin domain
5	PF00129 MHC_I	4.8e-93	321.2	Class I Histocompatibility antigen, domains alpha 1 and 2
6	PF06623 MHC_I_C	5.5e-11	53.4	MHC_I C-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000399168

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000375608	0.999	Killer cell immunoglobulin-like receptor 3DL1
2	9606.ENSP00000452780	0.999	Beta-2-microglobulin
3	9606.ENSP00000325525	0.992	Killer cell immunoglobulin-like receptor 3DL2
4	9606.ENSP00000375629	0.989	Leukocyte immunoglobulin-like receptor subfamily B member 2
5	9606.ENSP00000365402	0.981	HLA class I histocompatibility antigen, Cw-7 alpha chain
6	9606.ENSP00000363976	0.969	HLA class II histocompatibility antigen, DM alpha chain
7	9606.ENSP00000364016	0.967	Proteasome subunit beta type-8
8	9606.ENSP00000365817	0.962	HLA class I histocompatibility antigen, alpha chain E
9	9606.ENSP00000229829	0.959	HLA class II histocompatibility antigen, DO alpha chain
10	9606.ENSP00000386559	0.958	T-cell surface glycoprotein CD8 alpha chain
11	9606.ENSP00000342215	0.957	Killer cell immunoglobulin-like receptor 2DL3
12	9606.ENSP00000379873	0.953	HLA class I histocompatibility antigen, A-3 alpha chain
13	9606.ENSP00000315997	0.945	Leukocyte immunoglobulin-like receptor subfamily B member 1
14	9606.ENSP00000404833	0.943	Tapasin
15	9606.ENSP00000353099	0.941	HLA class II histocompatibility antigen, DRB1-15 beta chain
16	9606.ENSP00000393566	0.941	HLA class II histocompatibility antigen, DP alpha 1 chain
17	9606.ENSP00000354394	0.940	Signal transducer and activator of transcription 1-alpha/beta
18	9606.ENSP00000378786	0.938	HLA class II histocompatibility antigen, DR alpha chain
19	9606.ENSP00000245414	0.936	Interferon regulatory factor 1
20	9606.ENSP00000291860	0.936	Killer cell immunoglobulin-like receptor 3DL3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003823	0.920	antigen binding
GO:0042277	0.907	peptide binding
GO:0042605	0.809	peptide antigen binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0048518	0.991	positive regulation of biological process
GO:0002376	0.987	immune system process
GO:0002819	0.987	regulation of adaptive immune response
GO:0050896	0.986	response to stimulus
GO:0001910	0.978	regulation of leukocyte mediated cytotoxicity
GO:0002706	0.977	regulation of lymphocyte mediated immunity
GO:0009987	0.976	cellular process
GO:0002711	0.974	positive regulation of T cell mediated immunity
GO:0001912	0.972	positive regulation of leukocyte mediated cytotoxicity
GO:0048002	0.966	antigen processing and presentation of peptide antigen
GO:0001914	0.960	regulation of T cell mediated cytotoxicity
GO:0048519	0.959	negative regulation of biological process
GO:0006955	0.955	immune response
GO:0002683	0.939	negative regulation of immune system process
GO:0002831	0.919	regulation of response to biotic stimulus
GO:0048523	0.904	negative regulation of cellular process
GO:0031347	0.891	regulation of defense response
GO:0045088	0.875	regulation of innate immune response
GO:0006950	0.860	response to stress
GO:0001817	0.847	regulation of cytokine production
GO:0001819	0.832	positive regulation of cytokine production
GO:0032102	0.831	negative regulation of response to external stimulus
GO:0006952	0.812	defense response
GO:0050777	0.806	negative regulation of immune response
GO:0002698	0.768	negative regulation of immune effector process
GO:0031348	0.761	negative regulation of defense response
GO:0002704	0.760	negative regulation of leukocyte mediated immunity
GO:0002832	0.737	negative regulation of response to biotic stimulus
GO:0098542	0.718	defense response to other organism
GO:0045824	0.714	negative regulation of innate immune response
GO:0031342	0.683	negative regulation of cell killing
GO:0002707	0.676	negative regulation of lymphocyte mediated immunity
GO:0042269	0.667	regulation of natural killer cell mediated cytotoxicity
GO:0001911	0.627	negative regulation of leukocyte mediated cytotoxicity
GO:0051716	0.487	cellular response to stimulus
GO:0032501	0.377	multicellular organismal process
GO:0001916	0.351	positive regulation of T cell mediated cytotoxicity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0005886	0.999	plasma membrane
GO:0098588	0.999	bounding membrane of organelle
GO:0030659	0.997	cytoplasmic vesicle membrane
GO:0009986	0.996	cell surface
GO:0005789	0.988	endoplasmic reticulum membrane
GO:0030666	0.975	endocytic vesicle membrane
GO:0098553	0.975	lumenal side of endoplasmic reticulum membrane
GO:0030670	0.969	phagocytic vesicle membrane
GO:0065010	0.955	extracellular membrane-bounded organelle
GO:1903561	0.952	extracellular vesicle
GO:0012507	0.946	ER to Golgi transport vesicle membrane
GO:0070062	0.944	extracellular exosome
GO:0098796	0.912	membrane protein complex
GO:0005769	0.910	early endosome
GO:0005794	0.908	Golgi apparatus
GO:0010008	0.894	endosome membrane
GO:0055038	0.870	recycling endosome membrane
GO:0031901	0.858	early endosome membrane
GO:0000139	0.812	Golgi membrane
GO:0098797	0.775	plasma membrane protein complex
GO:0042611	0.740	MHC protein complex
GO:0005634	0.631	nucleus
GO:0009897	0.395	external side of plasma membrane
GO:0043233	0.365	organelle lumen
GO:0070013	0.364	intracellular organelle lumen
GO:0030141	0.341	secretory granule
GO:0098852	0.327	lytic vacuole membrane
GO:0005765	0.308	lysosomal membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]