StarFunc result for job id P01893

User Input

>input (362 residues)
MVLMAPRTLLLLLSGALALTQTWARSHSMRYFYTTMSRPGAGEPRFISVGYVDDTQFVRF
DSDDASPREEPRAPWMEREGPKYWDRNTQICKAQAQTERENLRIALRYYNQSEGGSHTMQ
VMYGCDVGPDGPFLRGYEQHAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAARRAEQR
RVYLEGEFVEWLRRYLENGKETLQRADPPKTHMTHHPISDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEP
SSQPTVPIVGIVAGLVLLVAVVTGAVVAAVMWRKKSSDRKGGSYSQAASSNSAQGSDVSL
TA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P01893	1.000	1.000	5.171E-67	362	1.000	1.000	P01893.pdb.gz	HLAH_HUMAN Putative HLA class I histocompatibility antigen, alpha chain H OS=Homo sapiens OX=9606 GN=HLA-H PE=5 SV=3
2	AFDB:P01889	0.829	0.829	1.784E-59	362	0.859	0.859	P01889.pdb.gz	HLAB_HUMAN HLA class I histocompatibility antigen, B alpha chain OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=3
3	AFDB:P04439	0.837	0.831	6.235E-59	365	0.856	0.849	P04439.pdb.gz	HLAA_HUMAN HLA class I histocompatibility antigen, A alpha chain OS=Homo sapiens OX=9606 GN=HLA-A PE=1 SV=2
4	AFDB:P10321	0.826	0.818	1.955E-58	366	0.812	0.803	P10321.pdb.gz	HLAC_HUMAN HLA class I histocompatibility antigen, C alpha chain OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=3
5	AFDB:A0A583ZBW8	0.845	0.836	2.968E-57	366	0.823	0.814	A0A583ZBW8.pdb.gz	A0A583ZBW8_HUMAN HLA-C protein OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=1
6	AFDB:P30511	0.859	0.897	1.362E-56	346	0.762	0.798	P30511.pdb.gz	HLAF_HUMAN HLA class I histocompatibility antigen, alpha chain F OS=Homo sapiens OX=9606 GN=HLA-F PE=1 SV=3
7	AFDB:P17693	0.833	0.891	1.137E-55	338	0.743	0.796	P17693.pdb.gz	HLAG_HUMAN HLA class I histocompatibility antigen, alpha chain G OS=Homo sapiens OX=9606 GN=HLA-G PE=1 SV=1
8	AFDB:P13747	0.778	0.786	3.442E-53	358	0.721	0.729	P13747.pdb.gz	HLAE_HUMAN HLA class I histocompatibility antigen, alpha chain E OS=Homo sapiens OX=9606 GN=HLA-E PE=1 SV=4
9	AFDB:Q95476	0.791	0.806	7.372E-53	355	0.693	0.707	Q95476.pdb.gz	Q95476_BOVIN MHC Class I (Fragment) OS=Bos taurus OX=9913 GN=JSP.1 PE=2 SV=1
10	AFDB:P01902	0.787	0.774	4.205E-52	368	0.663	0.652	P01902.pdb.gz	HA1D_MOUSE H-2 class I histocompatibility antigen, K-D alpha chain OS=Mus musculus OX=10090 GN=H2-K1 PE=1 SV=1
11	PDB:6d7gA	0.743	0.698	6.919E-44	386	0.619	0.580	6d7gA.pdb.gz
12	PDB:6e1iA	0.750	0.699	4.905E-43	389	0.583	0.542	6e1iA.pdb.gz
13	PDB:5j6hA	0.752	0.987	8.005E-43	275	0.566	0.745	5j6hA.pdb.gz	Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
14	PDB:6mp0A	0.736	0.688	6.566E-41	388	0.539	0.503	6mp0A.pdb.gz
15	PDB:2qriA	0.737	0.672	8.022E-40	398	0.533	0.485	2qriA.pdb.gz
16	PDB:3nwmA	0.737	0.696	2.382E-39	384	0.550	0.518	3nwmA.pdb.gz
17	PDB:3es6A	0.624	0.792	6.286E-26	277	0.279	0.365	3es6A.pdb.gz	Crystal structure of the novel complex formed between zinc alpha2-glycoprotein (ZAG) and prolactin-inducible protein (PIP) from human seminal plasma
18	PDB:6fgbA	0.577	0.759	9.929E-21	265	0.199	0.272	6fgbA.pdb.gz
19	PDB:3ov6A	0.597	0.577	4.645E-18	376	0.155	0.149	3ov6A.pdb.gz	The 2.5 A structure of CD1c in complex with a mycobacterial lipid reveals an open groove ideally suited for diverse antigen presentation
20	PDB:1cd1A	0.570	0.726	5.090E-17	273	0.155	0.205	1cd1A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A583ZBW8	0.0	559	366	0.812	0.803	A0A583ZBW8_HUMAN HLA-C protein OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=1
2	P01889	0.0	583	362	0.859	0.859	HLAB_HUMAN HLA class I histocompatibility antigen, B alpha chain OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=3
3	P01893	0.0	753	362	1.000	1.000	HLAH_HUMAN Putative HLA class I histocompatibility antigen, alpha chain H OS=Homo sapiens OX=9606 GN=HLA-H PE=5 SV=3
4	P04439	0.0	622	365	0.856	0.849	HLAA_HUMAN HLA class I histocompatibility antigen, A alpha chain OS=Homo sapiens OX=9606 GN=HLA-A PE=1 SV=2
5	P10321	0.0	531	366	0.801	0.792	HLAC_HUMAN HLA class I histocompatibility antigen, C alpha chain OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=3
6	P17693	0.0	536	338	0.743	0.796	HLAG_HUMAN HLA class I histocompatibility antigen, alpha chain G OS=Homo sapiens OX=9606 GN=HLA-G PE=1 SV=1
7	P30511	0.0	512	346	0.762	0.798	HLAF_HUMAN HLA class I histocompatibility antigen, alpha chain F OS=Homo sapiens OX=9606 GN=HLA-F PE=1 SV=3
8	Q53YP1	0.0	565	366	0.823	0.814	Q53YP1_HUMAN HLA class I histocompatibility antigen OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=1
9	Q5RIP0	0.0	577	366	0.826	0.817	Q5RIP0_HUMAN HLA class I histocompatibility antigen OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=1
10	Q5SUL5	0.0	621	365	0.856	0.849	Q5SUL5_HUMAN HLA class I histocompatibility antigen OS=Homo sapiens OX=9606 GN=HLA-A PE=1 SV=1
11	Q7YQB1	0.0	548	366	0.831	0.822	Q7YQB1_HUMAN MHC class I antigen OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=1
12	P13747	4.02e-177	498	358	0.710	0.718	HLAE_HUMAN HLA class I histocompatibility antigen, alpha chain E OS=Homo sapiens OX=9606 GN=HLA-E PE=1 SV=4
13	Q95476	3.29e-167	472	355	0.644	0.656	Q95476_BOVIN MHC Class I (Fragment) OS=Bos taurus OX=9913 GN=JSP.1 PE=2 SV=1
14	P01897	8.41e-165	466	362	0.666	0.666	HA1L_MOUSE H-2 class I histocompatibility antigen, L-D alpha chain OS=Mus musculus OX=10090 GN=H2-L PE=1 SV=2
15	P03991	5.82e-163	462	368	0.660	0.649	HA1W_MOUSE H-2 class I histocompatibility antigen, K-W28 alpha chain OS=Mus musculus OX=10090 GN=H2-K1 PE=1 SV=2
16	Q4KN81	1.17e-162	461	360	0.616	0.619	Q4KN81_MOUSE Histocompatibility 2, Q region locus 2 OS=Mus musculus OX=10090 GN=H2-Q2 PE=1 SV=1
17	P01900	2.23e-161	458	365	0.657	0.652	HA12_MOUSE H-2 class I histocompatibility antigen, D-D alpha chain OS=Mus musculus OX=10090 GN=H2-D1 PE=1 SV=1
18	P01902	5.44e-161	457	368	0.666	0.655	HA1D_MOUSE H-2 class I histocompatibility antigen, K-D alpha chain OS=Mus musculus OX=10090 GN=H2-K1 PE=1 SV=1
19	Q6SY93	2.67e-160	454	340	0.622	0.662	Q6SY93_RAT MHC class Ib antigen (Fragment) OS=Rattus norvegicus OX=10116 GN=RT1-L3 PE=3 SV=1
20	P14426	8.52e-160	454	362	0.660	0.660	HA13_MOUSE H-2 class I histocompatibility antigen, D-K alpha chain OS=Mus musculus OX=10090 GN=H2-D1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	1.4e-11	55.9	Immunoglobulin C1-set domain
2	PF08205 C2-set_2	3	19.3	CD80-like C2-set immunoglobulin domain
3	PF02656 DUF202	2.3e+02	13.7	Domain of unknown function (DUF202)
4	PF00047 ig	15	17.2	Immunoglobulin domain
5	PF13927 Ig_3	0.0072	28.2	Immunoglobulin domain
6	PF00129 MHC_I	1.4e-90	313.2	Class I Histocompatibility antigen, domains alpha 1 and 2
7	PF06623 MHC_I_C	9.4e-10	49.4	MHC_I C-terminus
8	PF03929 PepSY_TM	4.3e+02	12.0	PepSY-associated TM region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008953344.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008962050.1	0.990	Component of the class I major histocompatibility complex (MHC). Involved in the presentation of peptide antigens to the immune system
2	9597.XP_008958897.1	0.979	TAP binding protein
3	9597.XP_008967845.1	0.910	CD8b molecule
4	9597.XP_003814998.1	0.906	Protein disulfide isomerase family A member 3
5	9597.XP_003829677.1	0.899	Killer cell lectin like receptor D1
6	9597.XP_003829672.1	0.895	Killer cell lectin like receptor C1
7	9597.XP_003814880.1	0.888	Calreticulin
8	9597.XP_008953855.1	0.848	Killer cell immunoglobulin-like receptor 2DL3
9	9597.XP_008953864.1	0.848	Killer cell immunoglobulin like receptor, three Ig domains and long cytoplasmic tail 3
10	9597.XP_003829675.2	0.829	Killer cell lectin like receptor C4
11	9597.XP_008953228.1	0.829	Killer cell lectin like receptor C2
12	9597.XP_008953230.1	0.829	Killer cell lectin like receptor C3
13	9597.XP_008967848.1	0.807	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 311 ESTs, 9 Proteins, and 71% coverage of the annotated genomic feature by RNAseq alignments
14	9597.XP_008953333.1	0.735	Patr class I histocompatibility antigen, CH28 alpha chain isoform X1
15	9597.XP_008955201.1	0.716	Belongs to the MHC class I family.
16	9597.XP_008953850.1	0.715	Putative killer cell immunoglobulin-like receptor-like protein KIR3DX1
17	9597.XP_008953865.1	0.701	Killer cell immunoglobulin-like receptor 2DL4
18	9597.XP_008953345.1	0.698	Patr class I histocompatibility antigen, alpha chain G
19	9597.XP_003830222.1	0.693	Killer cell immunoglobulin-like receptor 2DL5A isoform X1
20	9597.XP_008960492.1	0.693	Killer cell immunoglobulin like receptor, three Ig domains and long cytoplasmic tail 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003823	0.920	antigen binding
GO:0042277	0.897	peptide binding
GO:0042605	0.846	peptide antigen binding
GO:0005102	0.692	signaling receptor binding
GO:0030881	0.525	beta-2-microglobulin binding
GO:0044877	0.508	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0002682	0.991	regulation of immune system process
GO:0050896	0.986	response to stimulus
GO:0048518	0.986	positive regulation of biological process
GO:0002376	0.985	immune system process
GO:0048583	0.985	regulation of response to stimulus
GO:0002709	0.975	regulation of T cell mediated immunity
GO:0001912	0.969	positive regulation of leukocyte mediated cytotoxicity
GO:0002711	0.969	positive regulation of T cell mediated immunity
GO:0009987	0.966	cellular process
GO:0048002	0.964	antigen processing and presentation of peptide antigen
GO:0001914	0.961	regulation of T cell mediated cytotoxicity
GO:0006955	0.952	immune response
GO:0048519	0.937	negative regulation of biological process
GO:0048523	0.899	negative regulation of cellular process
GO:0002683	0.887	negative regulation of immune system process
GO:0002831	0.862	regulation of response to biotic stimulus
GO:0031347	0.850	regulation of defense response
GO:0045088	0.834	regulation of innate immune response
GO:0032501	0.819	multicellular organismal process
GO:0001817	0.792	regulation of cytokine production
GO:0051707	0.777	response to other organism
GO:0001819	0.755	positive regulation of cytokine production
GO:0002698	0.733	negative regulation of immune effector process
GO:0006950	0.721	response to stress
GO:0050777	0.718	negative regulation of immune response
GO:0032102	0.709	negative regulation of response to external stimulus
GO:0006952	0.693	defense response
GO:0031348	0.687	negative regulation of defense response
GO:0042269	0.682	regulation of natural killer cell mediated cytotoxicity
GO:0031342	0.672	negative regulation of cell killing
GO:0019884	0.670	antigen processing and presentation of exogenous antigen
GO:0002252	0.668	immune effector process
GO:0002704	0.668	negative regulation of leukocyte mediated immunity
GO:0002478	0.664	antigen processing and presentation of exogenous peptide antigen
GO:0045824	0.656	negative regulation of innate immune response
GO:0002707	0.636	negative regulation of lymphocyte mediated immunity
GO:0001911	0.614	negative regulation of leukocyte mediated cytotoxicity
GO:0098542	0.588	defense response to other organism
GO:0002449	0.585	lymphocyte mediated immunity
GO:0002250	0.548	adaptive immune response
GO:0001906	0.494	cell killing
GO:0002460	0.494	adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0001909	0.473	leukocyte mediated cytotoxicity
GO:0051716	0.412	cellular response to stimulus
GO:0001916	0.346	positive regulation of T cell mediated cytotoxicity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0005886	0.999	plasma membrane
GO:0031410	0.998	cytoplasmic vesicle
GO:0009986	0.996	cell surface
GO:0098588	0.996	bounding membrane of organelle
GO:0030659	0.994	cytoplasmic vesicle membrane
GO:0005789	0.975	endoplasmic reticulum membrane
GO:0030666	0.971	endocytic vesicle membrane
GO:0032991	0.969	protein-containing complex
GO:0098553	0.967	lumenal side of endoplasmic reticulum membrane
GO:0030670	0.962	phagocytic vesicle membrane
GO:0055038	0.939	recycling endosome membrane
GO:0005794	0.938	Golgi apparatus
GO:0098796	0.933	membrane protein complex
GO:0000139	0.925	Golgi membrane
GO:0031901	0.918	early endosome membrane
GO:0030662	0.909	coated vesicle membrane
GO:0005576	0.904	extracellular region
GO:0012507	0.901	ER to Golgi transport vesicle membrane
GO:0098797	0.757	plasma membrane protein complex
GO:0042611	0.718	MHC protein complex
GO:0005615	0.591	extracellular space
GO:0000323	0.488	lytic vacuole
GO:0009897	0.487	external side of plasma membrane
GO:0005774	0.467	vacuolar membrane
GO:0098852	0.456	lytic vacuole membrane
GO:0099503	0.416	secretory vesicle
GO:0030141	0.403	secretory granule
GO:0065010	0.355	extracellular membrane-bounded organelle
GO:0030667	0.355	secretory granule membrane
GO:0070062	0.352	extracellular exosome
GO:0005764	0.347	lysosome
GO:0005765	0.312	lysosomal membrane
GO:0005634	0.302	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]