StarFunc result for job id P01903

User Input

>input (254 residues)
MAISGVPVLGFFIIAVLMSAQESWAIKEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVD
MAKKETVWRLEEFGRFASFEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNS
PVELREPNVLICFIDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPFLP
STEDVYDCRVEHWGLDEPLLKHWEFDAPSPLPETTENVVCALGLTVGLVGIIIGTIFIIK
GLRKSNAAERRGPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P01903	1.000	1.000	1.845E-44	254	1.000	1.000	P01903.pdb.gz	DRA_HUMAN HLA class II histocompatibility antigen, DR alpha chain OS=Homo sapiens OX=9606 GN=HLA-DRA PE=1 SV=2
2	AFDB:P01904	0.840	0.837	3.815E-36	255	0.740	0.737	P01904.pdb.gz	HA21_MOUSE H-2 class II histocompatibility antigen, E-D alpha chain OS=Mus musculus OX=10090 GN=H2-Ea PE=1 SV=2
3	PDB:6cplA	0.688	0.962	1.447E-32	180	0.709	1.000	6cplA.pdb.gz	CD4+T cell-mediated HLA class II cross-restriction in HIV controllers.
4	AFDB:P20036	0.780	0.763	3.345E-30	260	0.583	0.569	P20036.pdb.gz	DPA1_HUMAN HLA class II histocompatibility antigen, DP alpha 1 chain OS=Homo sapiens OX=9606 GN=HLA-DPA1 PE=1 SV=1
5	AFDB:P06340	0.724	0.734	2.510E-29	250	0.531	0.540	P06340.pdb.gz	DOA_HUMAN HLA class II histocompatibility antigen, DO alpha chain OS=Homo sapiens OX=9606 GN=HLA-DOA PE=1 SV=1
6	AFDB:P01906	0.849	0.846	4.046E-29	255	0.524	0.522	P01906.pdb.gz	DQA2_HUMAN HLA class II histocompatibility antigen, DQ alpha 2 chain OS=Homo sapiens OX=9606 GN=HLA-DQA2 PE=1 SV=2
7	AFDB:P01910	0.806	0.800	4.499E-29	256	0.531	0.527	P01910.pdb.gz	HA2K_MOUSE H-2 class II histocompatibility antigen, A-K alpha chain OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=2
8	AFDB:P01909	0.811	0.811	5.003E-29	254	0.531	0.531	P01909.pdb.gz	DQA1_HUMAN HLA class II histocompatibility antigen, DQ alpha 1 chain OS=Homo sapiens OX=9606 GN=HLA-DQA1 PE=1 SV=1
9	AFDB:P20037	0.772	0.767	4.642E-28	256	0.531	0.527	P20037.pdb.gz	HA2B_RAT Rano class II histocompatibility antigen, B alpha chain OS=Rattus norvegicus OX=10116 GN=RT1-Ba PE=3 SV=1
10	AFDB:B2RST7	0.701	0.712	1.084E-27	250	0.472	0.480	B2RST7.pdb.gz	B2RST7_MOUSE Histocompatibility 2, O region alpha locus OS=Mus musculus OX=10090 GN=H2-Oa PE=2 SV=1
11	AFDB:P28078	0.615	0.600	7.666E-17	261	0.268	0.261	P28078.pdb.gz	DMA_MOUSE Class II histocompatibility antigen, M alpha chain OS=Mus musculus OX=10090 GN=H2-DMa PE=1 SV=1
12	PDB:5j6hA	0.355	0.331	7.457E-10	275	0.161	0.149	5j6hA.pdb.gz	Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
13	PDB:6fgbA	0.341	0.328	1.409E-9	265	0.157	0.151	6fgbA.pdb.gz
14	PDB:6e1iA	0.368	0.249	4.293E-9	389	0.154	0.100	6e1iA.pdb.gz
15	PDB:3nwmA	0.372	0.256	8.554E-9	384	0.157	0.104	3nwmA.pdb.gz
16	PDB:6mp0A	0.376	0.256	1.003E-8	388	0.173	0.113	6mp0A.pdb.gz
17	PDB:2qriA	0.378	0.251	1.115E-8	398	0.157	0.101	2qriA.pdb.gz
18	PDB:3es6A	0.355	0.328	1.454E-8	277	0.146	0.134	3es6A.pdb.gz	Crystal structure of the novel complex formed between zinc alpha2-glycoprotein (ZAG) and prolactin-inducible protein (PIP) from human seminal plasma
19	PDB:1kjvB	0.367	0.902	1.533E-8	100	0.122	0.310	1kjvB.pdb.gz	Crystal structures of two rat MHC class Ia (RT1-A) molecules that are associated differentially with peptide transporter alleles TAP-A and TAP-B.
20	PDB:6d7gA	0.372	0.252	2.222E-8	386	0.126	0.083	6d7gA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P01903	0.0	521	254	1.000	1.000	DRA_HUMAN HLA class II histocompatibility antigen, DR alpha chain OS=Homo sapiens OX=9606 GN=HLA-DRA PE=1 SV=2
2	P14439	1.54e-144	406	255	0.748	0.745	HA23_MOUSE H-2 class II histocompatibility antigen, E-U alpha chain OS=Mus musculus OX=10090 GN=H2-Ea PE=2 SV=2
3	P01904	5.71e-143	402	255	0.748	0.745	HA21_MOUSE H-2 class II histocompatibility antigen, E-D alpha chain OS=Mus musculus OX=10090 GN=H2-Ea PE=1 SV=2
4	Q95HB9	8.60e-98	288	260	0.575	0.562	Q95HB9_HUMAN HLA class II histocompatibility antigen DP alpha chain OS=Homo sapiens OX=9606 GN=HLA-DPA1 PE=1 SV=1
5	P06340	8.37e-97	285	250	0.531	0.540	DOA_HUMAN HLA class II histocompatibility antigen, DO alpha chain OS=Homo sapiens OX=9606 GN=HLA-DOA PE=1 SV=1
6	P14436	1.19e-96	284	233	0.531	0.579	HA2R_MOUSE H-2 class II histocompatibility antigen, A-R alpha chain OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=1
7	P04228	1.47e-96	285	256	0.543	0.539	HA2D_MOUSE H-2 class II histocompatibility antigen, A-D alpha chain OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=1
8	P14435	2.04e-96	283	233	0.528	0.575	HA2F_MOUSE H-2 class II histocompatibility antigen, A-F alpha chain OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=1
9	P20036	1.88e-95	282	260	0.567	0.554	DPA1_HUMAN HLA class II histocompatibility antigen, DP alpha 1 chain OS=Homo sapiens OX=9606 GN=HLA-DPA1 PE=1 SV=1
10	X5CKE2	1.88e-95	282	260	0.567	0.554	X5CKE2_HUMAN HLA class II histocompatibility antigen DP alpha chain OS=Homo sapiens OX=9606 GN=HLA-DPA1 PE=3 SV=1
11	P14434	2.71e-95	281	256	0.531	0.527	HA2B_MOUSE H-2 class II histocompatibility antigen, A-B alpha chain OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=2
12	P23150	3.64e-95	281	254	0.528	0.528	HA2J_MOUSE H-2 class II histocompatibility antigen, I-E alpha chain (Fragment) OS=Mus musculus OX=10090 PE=1 SV=1
13	P01910	1.79e-94	280	256	0.508	0.504	HA2K_MOUSE H-2 class II histocompatibility antigen, A-K alpha chain OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=2
14	P14437	2.82e-94	278	233	0.516	0.562	HA2S_MOUSE H-2 class II histocompatibility antigen, A-S alpha chain OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=1
15	P04227	5.42e-94	277	221	0.512	0.588	HA2Q_MOUSE H-2 class II histocompatibility antigen, A-Q alpha chain (Fragment) OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=1
16	P20037	1.14e-93	278	256	0.535	0.531	HA2B_RAT Rano class II histocompatibility antigen, B alpha chain OS=Rattus norvegicus OX=10116 GN=RT1-Ba PE=3 SV=1
17	P14438	5.97e-93	275	227	0.492	0.551	HA2U_MOUSE H-2 class II histocompatibility antigen, A-U alpha chain (Fragment) OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=1
18	P01906	4.22e-90	268	255	0.492	0.490	DQA2_HUMAN HLA class II histocompatibility antigen, DQ alpha 2 chain OS=Homo sapiens OX=9606 GN=HLA-DQA2 PE=1 SV=2
19	P01909	5.92e-90	268	254	0.531	0.531	DQA1_HUMAN HLA class II histocompatibility antigen, DQ alpha 1 chain OS=Homo sapiens OX=9606 GN=HLA-DQA1 PE=1 SV=1
20	Q31150	9.72e-75	229	250	0.484	0.492	Q31150_MOUSE MHC class II alpha chain OS=Mus musculus OX=10090 GN=H2-Oa PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	5.8e-20	82.8	Immunoglobulin C1-set domain
2	PF08205 C2-set_2	4e+02	12.5	CD80-like C2-set immunoglobulin domain
3	PF13927 Ig_3	1.1	21.1	Immunoglobulin domain
4	PF00993 MHC_II_alpha	5.4e-31	117.4	Class II histocompatibility antigen, alpha domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378786

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000009530	0.999	HLA class II histocompatibility antigen gamma chain
2	9606.ENSP00000353099	0.999	HLA class II histocompatibility antigen, DRB1-15 beta chain
3	9606.ENSP00000398890	0.999	HLA class II histocompatibility antigen, DM beta chain
4	9606.ENSP00000363976	0.997	HLA class II histocompatibility antigen, DM alpha chain
5	9606.ENSP00000364114	0.997	HLA class II histocompatibility antigen, DR beta 5 chain
6	9606.ENSP00000011653	0.991	T-cell surface glycoprotein CD4
7	9606.ENSP00000408146	0.961	HLA class II histocompatibility antigen, DP beta 1 chain
8	9606.ENSP00000365817	0.959	HLA class I histocompatibility antigen, alpha chain E
9	9606.ENSP00000393566	0.955	HLA class II histocompatibility antigen, DP alpha 1 chain
10	9606.ENSP00000332049	0.954	T-lymphocyte activation antigen CD86
11	9606.ENSP00000390431	0.953	Major histocompatibility complex, class II, DQ beta 2
12	9606.ENSP00000357981	0.951	Cathepsin S
13	9606.ENSP00000411355	0.947	Receptor-type tyrosine-protein phosphatase C
14	9606.ENSP00000356429	0.941	Regulator of G-protein signaling 1
15	9606.ENSP00000300692	0.940	T-cell surface glycoprotein CD3 delta chain
16	9606.ENSP00000399168	0.938	HLA class I histocompatibility antigen, B-7 alpha chain
17	9606.ENSP00000354566	0.937	T-cell surface glycoprotein CD3 epsilon chain
18	9606.ENSP00000390020	0.936	HLA class II histocompatibility antigen, DO beta chain
19	9606.ENSP00000264246	0.935	T-lymphocyte activation antigen CD80
20	9606.ENSP00000370989	0.935	Programmed cell death 1 ligand 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042605	0.999	peptide antigen binding
GO:0044877	0.981	protein-containing complex binding
GO:0030247	0.596	polysaccharide binding
GO:0023023	0.591	MHC protein complex binding
GO:0005102	0.590	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0048518	0.994	positive regulation of biological process
GO:0050794	0.990	regulation of cellular process
GO:0002376	0.983	immune system process
GO:0048522	0.979	positive regulation of cellular process
GO:1903037	0.977	regulation of leukocyte cell-cell adhesion
GO:0002684	0.976	positive regulation of immune system process
GO:0050863	0.975	regulation of T cell activation
GO:0051240	0.965	positive regulation of multicellular organismal process
GO:0048002	0.960	antigen processing and presentation of peptide antigen
GO:0019886	0.950	antigen processing and presentation of exogenous peptide antigen via MHC class II
GO:0051251	0.938	positive regulation of lymphocyte activation
GO:0050776	0.903	regulation of immune response
GO:0022409	0.896	positive regulation of cell-cell adhesion
GO:0009987	0.894	cellular process
GO:0050778	0.894	positive regulation of immune response
GO:0050896	0.892	response to stimulus
GO:1903039	0.888	positive regulation of leukocyte cell-cell adhesion
GO:0050870	0.875	positive regulation of T cell activation
GO:0060284	0.547	regulation of cell development
GO:0045580	0.475	regulation of T cell differentiation
GO:0006955	0.459	immune response
GO:1902107	0.390	positive regulation of leukocyte differentiation
GO:0045582	0.369	positive regulation of T cell differentiation
GO:0032501	0.324	multicellular organismal process
GO:0048519	0.316	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	1.000	plasma membrane
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.993	endomembrane system
GO:0031982	0.993	vesicle
GO:0009986	0.988	cell surface
GO:0098552	0.981	side of membrane
GO:0000323	0.980	lytic vacuole
GO:0032991	0.968	protein-containing complex
GO:0031090	0.956	organelle membrane
GO:0005576	0.955	extracellular region
GO:0097708	0.947	intracellular vesicle
GO:0031410	0.944	cytoplasmic vesicle
GO:0098588	0.936	bounding membrane of organelle
GO:0030659	0.929	cytoplasmic vesicle membrane
GO:0005783	0.916	endoplasmic reticulum
GO:0031984	0.909	organelle subcompartment
GO:0070062	0.892	extracellular exosome
GO:0030135	0.857	coated vesicle
GO:0042175	0.839	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0030139	0.831	endocytic vesicle
GO:0030662	0.812	coated vesicle membrane
GO:0005789	0.805	endoplasmic reticulum membrane
GO:0005764	0.761	lysosome
GO:0030134	0.751	COPII-coated ER to Golgi transport vesicle
GO:0098796	0.740	membrane protein complex
GO:0005794	0.740	Golgi apparatus
GO:0098576	0.709	lumenal side of membrane
GO:0098553	0.688	lumenal side of endoplasmic reticulum membrane
GO:0005768	0.640	endosome
GO:0098797	0.631	plasma membrane protein complex
GO:0030666	0.624	endocytic vesicle membrane
GO:0012507	0.565	ER to Golgi transport vesicle membrane
GO:0042611	0.554	MHC protein complex
GO:0030136	0.531	clathrin-coated vesicle
GO:0009897	0.517	external side of plasma membrane
GO:0030665	0.506	clathrin-coated vesicle membrane
GO:0045334	0.505	clathrin-coated endocytic vesicle
GO:0098791	0.487	Golgi apparatus subcompartment
GO:0005802	0.480	trans-Golgi network
GO:0042613	0.456	MHC class II protein complex
GO:0030669	0.449	clathrin-coated endocytic vesicle membrane
GO:0032588	0.441	trans-Golgi network membrane
GO:0005765	0.407	lysosomal membrane
GO:0000139	0.382	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]