StarFunc result for job id P01906

User Input

>input (255 residues)
MILNKALLLGALALTAVMSPCGGEDIVADHVASYGVNFYQSHGPSGQYTHEFDGDEEFYV
DLETKETVWQLPMFSKFISFDPQSALRNMAVGKHTLEFMMRQSNSTAATNEVPEVTVFSK
FPVTLGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFL
PSADEIYDCKVEHWGLDEPLLKHWEPEIPAPMSELTETLVCALGLSVGLMGIVVGTVFII
QGLRSVGASRHQGLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P01906	1.000	1.000	5.652E-45	255	1.000	1.000	P01906.pdb.gz	DQA2_HUMAN HLA class II histocompatibility antigen, DQ alpha 2 chain OS=Homo sapiens OX=9606 GN=HLA-DQA2 PE=1 SV=2
2	AFDB:P01909	0.896	0.900	8.833E-40	254	0.859	0.862	P01909.pdb.gz	DQA1_HUMAN HLA class II histocompatibility antigen, DQ alpha 1 chain OS=Homo sapiens OX=9606 GN=HLA-DQA1 PE=1 SV=1
3	AFDB:P01910	0.866	0.863	1.531E-35	256	0.706	0.703	P01910.pdb.gz	HA2K_MOUSE H-2 class II histocompatibility antigen, A-K alpha chain OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=2
4	AFDB:P20037	0.848	0.844	4.983E-35	256	0.729	0.727	P20037.pdb.gz	HA2B_RAT Rano class II histocompatibility antigen, B alpha chain OS=Rattus norvegicus OX=10116 GN=RT1-Ba PE=3 SV=1
5	AFDB:P06340	0.751	0.765	5.053E-31	250	0.529	0.540	P06340.pdb.gz	DOA_HUMAN HLA class II histocompatibility antigen, DO alpha chain OS=Homo sapiens OX=9606 GN=HLA-DOA PE=1 SV=1
6	AFDB:P20036	0.749	0.736	1.327E-30	260	0.553	0.542	P20036.pdb.gz	DPA1_HUMAN HLA class II histocompatibility antigen, DP alpha 1 chain OS=Homo sapiens OX=9606 GN=HLA-DPA1 PE=1 SV=1
7	AFDB:B2RST7	0.741	0.755	1.331E-29	250	0.494	0.504	B2RST7.pdb.gz	B2RST7_MOUSE Histocompatibility 2, O region alpha locus OS=Mus musculus OX=10090 GN=H2-Oa PE=2 SV=1
8	AFDB:P01903	0.847	0.850	3.313E-29	254	0.522	0.524	P01903.pdb.gz	DRA_HUMAN HLA class II histocompatibility antigen, DR alpha chain OS=Homo sapiens OX=9606 GN=HLA-DRA PE=1 SV=2
9	AFDB:P01904	0.769	0.769	9.210E-28	255	0.494	0.494	P01904.pdb.gz	HA21_MOUSE H-2 class II histocompatibility antigen, E-D alpha chain OS=Mus musculus OX=10090 GN=H2-Ea PE=1 SV=2
10	PDB:6cplA	0.677	0.953	1.828E-23	180	0.392	0.556	6cplA.pdb.gz	CD4+T cell-mediated HLA class II cross-restriction in HIV controllers.
11	AFDB:P28078	0.618	0.605	1.062E-17	261	0.271	0.264	P28078.pdb.gz	DMA_MOUSE Class II histocompatibility antigen, M alpha chain OS=Mus musculus OX=10090 GN=H2-DMa PE=1 SV=1
12	PDB:1kjvB	0.375	0.927	1.549E-9	100	0.114	0.290	1kjvB.pdb.gz	Crystal structures of two rat MHC class Ia (RT1-A) molecules that are associated differentially with peptide transporter alleles TAP-A and TAP-B.
13	PDB:2qriA	0.389	0.251	1.819E-9	398	0.114	0.073	2qriA.pdb.gz
14	PDB:5j6hA	0.337	0.316	3.281E-9	275	0.137	0.127	5j6hA.pdb.gz	Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
15	PDB:3nwmA	0.381	0.255	6.245E-9	384	0.114	0.076	3nwmA.pdb.gz
16	PDB:6mp0A	0.370	0.244	7.335E-9	388	0.125	0.082	6mp0A.pdb.gz
17	PDB:6e1iA	0.334	0.228	7.739E-9	389	0.133	0.087	6e1iA.pdb.gz
18	PDB:3es6A	0.355	0.330	9.591E-9	277	0.133	0.123	3es6A.pdb.gz	Crystal structure of the novel complex formed between zinc alpha2-glycoprotein (ZAG) and prolactin-inducible protein (PIP) from human seminal plasma
19	PDB:6d7gA	0.330	0.227	1.554E-8	386	0.118	0.078	6d7gA.pdb.gz
20	PDB:3ov6A	0.375	0.257	2.518E-8	376	0.110	0.074	3ov6A.pdb.gz	The 2.5 A structure of CD1c in complex with a mycobacterial lipid reveals an open groove ideally suited for diverse antigen presentation

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P01906	0.0	526	255	1.000	1.000	DQA2_HUMAN HLA class II histocompatibility antigen, DQ alpha 2 chain OS=Homo sapiens OX=9606 GN=HLA-DQA2 PE=1 SV=2
2	P01909	1.81e-162	452	254	0.863	0.866	DQA1_HUMAN HLA class II histocompatibility antigen, DQ alpha 1 chain OS=Homo sapiens OX=9606 GN=HLA-DQA1 PE=1 SV=1
3	P20037	5.57e-141	397	256	0.729	0.727	HA2B_RAT Rano class II histocompatibility antigen, B alpha chain OS=Rattus norvegicus OX=10116 GN=RT1-Ba PE=3 SV=1
4	P01910	4.75e-133	377	256	0.710	0.707	HA2K_MOUSE H-2 class II histocompatibility antigen, A-K alpha chain OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=2
5	P23150	9.51e-132	374	254	0.706	0.709	HA2J_MOUSE H-2 class II histocompatibility antigen, I-E alpha chain (Fragment) OS=Mus musculus OX=10090 PE=1 SV=1
6	P14434	3.02e-131	373	256	0.706	0.703	HA2B_MOUSE H-2 class II histocompatibility antigen, A-B alpha chain OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=2
7	P04228	2.47e-130	370	256	0.702	0.699	HA2D_MOUSE H-2 class II histocompatibility antigen, A-D alpha chain OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=1
8	P14437	1.48e-125	357	233	0.663	0.725	HA2S_MOUSE H-2 class II histocompatibility antigen, A-S alpha chain OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=1
9	P14436	1.06e-123	353	233	0.659	0.721	HA2R_MOUSE H-2 class II histocompatibility antigen, A-R alpha chain OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=1
10	P14435	5.35e-123	351	233	0.655	0.717	HA2F_MOUSE H-2 class II histocompatibility antigen, A-F alpha chain OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=1
11	P14438	4.31e-121	346	227	0.639	0.718	HA2U_MOUSE H-2 class II histocompatibility antigen, A-U alpha chain (Fragment) OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=1
12	P04227	2.11e-117	336	221	0.635	0.733	HA2Q_MOUSE H-2 class II histocompatibility antigen, A-Q alpha chain (Fragment) OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=1
13	P06340	4.32e-97	286	250	0.529	0.540	DOA_HUMAN HLA class II histocompatibility antigen, DO alpha chain OS=Homo sapiens OX=9606 GN=HLA-DOA PE=1 SV=1
14	Q95HB9	9.42e-92	273	260	0.553	0.542	Q95HB9_HUMAN HLA class II histocompatibility antigen DP alpha chain OS=Homo sapiens OX=9606 GN=HLA-DPA1 PE=1 SV=1
15	P20036	3.98e-91	271	260	0.553	0.542	DPA1_HUMAN HLA class II histocompatibility antigen, DP alpha 1 chain OS=Homo sapiens OX=9606 GN=HLA-DPA1 PE=1 SV=1
16	X5CKE2	3.98e-91	271	260	0.553	0.542	X5CKE2_HUMAN HLA class II histocompatibility antigen DP alpha chain OS=Homo sapiens OX=9606 GN=HLA-DPA1 PE=3 SV=1
17	P14439	1.33e-85	257	255	0.502	0.502	HA23_MOUSE H-2 class II histocompatibility antigen, E-U alpha chain OS=Mus musculus OX=10090 GN=H2-Ea PE=2 SV=2
18	P01904	2.29e-82	249	255	0.490	0.490	HA21_MOUSE H-2 class II histocompatibility antigen, E-D alpha chain OS=Mus musculus OX=10090 GN=H2-Ea PE=1 SV=2
19	P01903	3.14e-82	248	254	0.522	0.524	DRA_HUMAN HLA class II histocompatibility antigen, DR alpha chain OS=Homo sapiens OX=9606 GN=HLA-DRA PE=1 SV=2
20	Q31150	1.96e-80	244	250	0.502	0.512	Q31150_MOUSE MHC class II alpha chain OS=Mus musculus OX=10090 GN=H2-Oa PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	8.4e-22	88.7	Immunoglobulin C1-set domain
2	PF08205 C2-set_2	3.7	19.0	CD80-like C2-set immunoglobulin domain
3	PF13927 Ig_3	0.77	21.7	Immunoglobulin domain
4	PF00993 MHC_II_alpha	1.9e-32	122.1	Class II histocompatibility antigen, alpha domain
5	PF00397 WW	56	15.2	WW domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364076

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000390431	0.990	Major histocompatibility complex, class II, DQ beta 2
2	9606.ENSP00000364080	0.974	HLA class II histocompatibility antigen, DQ beta 1 chain
3	9606.ENSP00000352833	0.938	Tyrosine-protein phosphatase non-receptor type 22
4	9606.ENSP00000009530	0.937	HLA class II histocompatibility antigen gamma chain
5	9606.ENSP00000357981	0.928	Cathepsin S
6	9606.ENSP00000370989	0.924	Programmed cell death 1 ligand 1
7	9606.ENSP00000380855	0.922	Programmed cell death 1 ligand 2
8	9606.ENSP00000411355	0.916	Receptor-type tyrosine-protein phosphatase C
9	9606.ENSP00000335062	0.915	Programmed cell death protein 1
10	9606.ENSP00000263125	0.914	Protein kinase C theta type
11	9606.ENSP00000220166	0.913	Pro-cathepsin H
12	9606.ENSP00000345672	0.913	Cathepsin B
13	9606.ENSP00000220003	0.911	Tyrosine-protein kinase CSK
14	9606.ENSP00000345344	0.904	Cathepsin L1
15	9606.ENSP00000350911	0.904	Cathepsin E
16	9606.ENSP00000227266	0.903	Dipeptidyl peptidase 1
17	9606.ENSP00000376911	0.903	Legumain
18	9606.ENSP00000391592	0.903	Tyrosine-protein phosphatase non-receptor type 6
19	9606.ENSP00000236671	0.902	Cathepsin D
20	9606.ENSP00000244007	0.901	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042277	0.788	peptide binding
GO:0003823	0.732	antigen binding
GO:0042605	0.721	peptide antigen binding
GO:0044877	0.497	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0002376	0.990	immune system process
GO:0050794	0.987	regulation of cellular process
GO:0002682	0.984	regulation of immune system process
GO:0048522	0.966	positive regulation of cellular process
GO:0051249	0.963	regulation of lymphocyte activation
GO:0050863	0.948	regulation of T cell activation
GO:0002684	0.947	positive regulation of immune system process
GO:0022407	0.925	regulation of cell-cell adhesion
GO:0009987	0.817	cellular process
GO:0051240	0.791	positive regulation of multicellular organismal process
GO:0019882	0.776	antigen processing and presentation
GO:0048002	0.750	antigen processing and presentation of peptide antigen
GO:1903037	0.744	regulation of leukocyte cell-cell adhesion
GO:0002696	0.597	positive regulation of leukocyte activation
GO:0045785	0.564	positive regulation of cell adhesion
GO:0050896	0.561	response to stimulus
GO:0022409	0.554	positive regulation of cell-cell adhesion
GO:0051251	0.543	positive regulation of lymphocyte activation
GO:0019884	0.512	antigen processing and presentation of exogenous antigen
GO:0002495	0.509	antigen processing and presentation of peptide antigen via MHC class II
GO:1903039	0.506	positive regulation of leukocyte cell-cell adhesion
GO:0002478	0.497	antigen processing and presentation of exogenous peptide antigen
GO:0050870	0.493	positive regulation of T cell activation
GO:1902105	0.471	regulation of leukocyte differentiation
GO:0048519	0.457	negative regulation of biological process
GO:0019886	0.391	antigen processing and presentation of exogenous peptide antigen via MHC class II
GO:0051094	0.380	positive regulation of developmental process
GO:0045580	0.373	regulation of T cell differentiation
GO:0048583	0.337	regulation of response to stimulus
GO:0010720	0.327	positive regulation of cell development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0005886	0.999	plasma membrane
GO:0098588	0.999	bounding membrane of organelle
GO:0005764	0.999	lysosome
GO:0031984	0.998	organelle subcompartment
GO:0030135	0.998	coated vesicle
GO:0030659	0.998	cytoplasmic vesicle membrane
GO:0098552	0.997	side of membrane
GO:0030662	0.992	coated vesicle membrane
GO:0032991	0.989	protein-containing complex
GO:0030658	0.987	transport vesicle membrane
GO:0030134	0.986	COPII-coated ER to Golgi transport vesicle
GO:0005765	0.980	lysosomal membrane
GO:0000139	0.975	Golgi membrane
GO:0030666	0.974	endocytic vesicle membrane
GO:0005789	0.971	endoplasmic reticulum membrane
GO:0012507	0.970	ER to Golgi transport vesicle membrane
GO:0098576	0.969	lumenal side of membrane
GO:0032588	0.966	trans-Golgi network membrane
GO:0098553	0.956	lumenal side of endoplasmic reticulum membrane
GO:0030136	0.946	clathrin-coated vesicle
GO:0030665	0.936	clathrin-coated vesicle membrane
GO:0045334	0.935	clathrin-coated endocytic vesicle
GO:0030669	0.914	clathrin-coated endocytic vesicle membrane
GO:0098796	0.879	membrane protein complex
GO:0005768	0.796	endosome
GO:0098797	0.754	plasma membrane protein complex
GO:0070062	0.616	extracellular exosome
GO:0010008	0.609	endosome membrane
GO:0009986	0.535	cell surface
GO:0042613	0.532	MHC class II protein complex
GO:0005829	0.303	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]