StarFunc result for job id P01909

User Input

>input (254 residues)
MILNKALMLGALALTTVMSPCGGEDIVADHVASYGVNLYQSYGPSGQYTHEFDGDEQFYV
DLGRKETVWCLPVLRQFRFDPQFALTNIAVLKHNLNSLIKRSNSTAATNEVPEVTVFSKS
PVTLGQPNILICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTLLP
SAEESYDCKVEHWGLDKPLLKHWEPEIPAPMSELTETVVCALGLSVGLVGIVVGTVFIIR
GLRSVGASRHQGPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P01909	1.000	1.000	6.628E-45	254	1.000	1.000	P01909.pdb.gz	DQA1_HUMAN HLA class II histocompatibility antigen, DQ alpha 1 chain OS=Homo sapiens OX=9606 GN=HLA-DQA1 PE=1 SV=1
2	AFDB:P01906	0.899	0.896	1.086E-39	255	0.862	0.859	P01906.pdb.gz	DQA2_HUMAN HLA class II histocompatibility antigen, DQ alpha 2 chain OS=Homo sapiens OX=9606 GN=HLA-DQA2 PE=1 SV=2
3	AFDB:P01910	0.857	0.851	6.121E-35	256	0.717	0.711	P01910.pdb.gz	HA2K_MOUSE H-2 class II histocompatibility antigen, A-K alpha chain OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=2
4	AFDB:P20037	0.849	0.842	6.811E-35	256	0.720	0.715	P20037.pdb.gz	HA2B_RAT Rano class II histocompatibility antigen, B alpha chain OS=Rattus norvegicus OX=10116 GN=RT1-Ba PE=3 SV=1
5	AFDB:P06340	0.743	0.754	1.481E-31	250	0.551	0.560	P06340.pdb.gz	DOA_HUMAN HLA class II histocompatibility antigen, DO alpha chain OS=Homo sapiens OX=9606 GN=HLA-DOA PE=1 SV=1
6	AFDB:P20036	0.717	0.702	2.251E-30	260	0.579	0.565	P20036.pdb.gz	DPA1_HUMAN HLA class II histocompatibility antigen, DP alpha 1 chain OS=Homo sapiens OX=9606 GN=HLA-DPA1 PE=1 SV=1
7	AFDB:B2RST7	0.735	0.746	2.917E-29	250	0.492	0.500	B2RST7.pdb.gz	B2RST7_MOUSE Histocompatibility 2, O region alpha locus OS=Mus musculus OX=10090 GN=H2-Oa PE=2 SV=1
8	AFDB:P01903	0.811	0.811	3.611E-29	254	0.531	0.531	P01903.pdb.gz	DRA_HUMAN HLA class II histocompatibility antigen, DR alpha chain OS=Homo sapiens OX=9606 GN=HLA-DRA PE=1 SV=2
9	AFDB:P01904	0.716	0.713	8.874E-28	255	0.484	0.482	P01904.pdb.gz	HA21_MOUSE H-2 class II histocompatibility antigen, E-D alpha chain OS=Mus musculus OX=10090 GN=H2-Ea PE=1 SV=2
10	PDB:6cplA	0.677	0.949	1.141E-22	180	0.390	0.550	6cplA.pdb.gz	CD4+T cell-mediated HLA class II cross-restriction in HIV controllers.
11	AFDB:P28067	0.625	0.609	1.462E-16	261	0.240	0.234	P28067.pdb.gz	DMA_HUMAN HLA class II histocompatibility antigen, DM alpha chain OS=Homo sapiens OX=9606 GN=HLA-DMA PE=1 SV=1
12	PDB:1kjvB	0.376	0.926	2.416E-9	100	0.106	0.270	1kjvB.pdb.gz	Crystal structures of two rat MHC class Ia (RT1-A) molecules that are associated differentially with peptide transporter alleles TAP-A and TAP-B.
13	PDB:2qriA	0.390	0.251	2.549E-9	398	0.110	0.070	2qriA.pdb.gz
14	PDB:5j6hA	0.331	0.309	4.346E-9	275	0.142	0.131	5j6hA.pdb.gz	Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
15	PDB:3nwmA	0.383	0.255	6.661E-9	384	0.110	0.073	3nwmA.pdb.gz
16	PDB:6e1iA	0.374	0.245	7.817E-9	389	0.106	0.069	6e1iA.pdb.gz
17	PDB:6mp0A	0.371	0.244	7.817E-9	388	0.122	0.080	6mp0A.pdb.gz
18	PDB:3es6A	0.357	0.330	1.264E-8	277	0.154	0.141	3es6A.pdb.gz	Crystal structure of the novel complex formed between zinc alpha2-glycoprotein (ZAG) and prolactin-inducible protein (PIP) from human seminal plasma
19	PDB:6d7gA	0.335	0.231	1.406E-8	386	0.114	0.075	6d7gA.pdb.gz
20	PDB:3ov6A	0.376	0.257	2.043E-8	376	0.106	0.072	3ov6A.pdb.gz	The 2.5 A structure of CD1c in complex with a mycobacterial lipid reveals an open groove ideally suited for diverse antigen presentation

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P01909	0.0	524	254	1.000	1.000	DQA1_HUMAN HLA class II histocompatibility antigen, DQ alpha 1 chain OS=Homo sapiens OX=9606 GN=HLA-DQA1 PE=1 SV=1
2	P01906	6.65e-152	425	255	0.811	0.808	DQA2_HUMAN HLA class II histocompatibility antigen, DQ alpha 2 chain OS=Homo sapiens OX=9606 GN=HLA-DQA2 PE=1 SV=2
3	P20037	3.13e-135	383	256	0.724	0.719	HA2B_RAT Rano class II histocompatibility antigen, B alpha chain OS=Rattus norvegicus OX=10116 GN=RT1-Ba PE=3 SV=1
4	P01910	9.90e-131	371	256	0.724	0.719	HA2K_MOUSE H-2 class II histocompatibility antigen, A-K alpha chain OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=2
5	P14434	1.17e-130	371	256	0.720	0.715	HA2B_MOUSE H-2 class II histocompatibility antigen, A-B alpha chain OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=2
6	P04228	7.22e-128	364	256	0.717	0.711	HA2D_MOUSE H-2 class II histocompatibility antigen, A-D alpha chain OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=1
7	P23150	2.37e-127	363	254	0.713	0.713	HA2J_MOUSE H-2 class II histocompatibility antigen, I-E alpha chain (Fragment) OS=Mus musculus OX=10090 PE=1 SV=1
8	P14436	2.25e-121	347	233	0.665	0.725	HA2R_MOUSE H-2 class II histocompatibility antigen, A-R alpha chain OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=1
9	P14437	1.72e-120	345	233	0.661	0.721	HA2S_MOUSE H-2 class II histocompatibility antigen, A-S alpha chain OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=1
10	P14435	3.87e-119	341	233	0.661	0.721	HA2F_MOUSE H-2 class II histocompatibility antigen, A-F alpha chain OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=1
11	P14438	8.21e-119	340	227	0.650	0.727	HA2U_MOUSE H-2 class II histocompatibility antigen, A-U alpha chain (Fragment) OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=1
12	P04227	2.70e-114	328	221	0.638	0.733	HA2Q_MOUSE H-2 class II histocompatibility antigen, A-Q alpha chain (Fragment) OS=Mus musculus OX=10090 GN=H2-Aa PE=1 SV=1
13	P06340	1.67e-98	290	250	0.555	0.564	DOA_HUMAN HLA class II histocompatibility antigen, DO alpha chain OS=Homo sapiens OX=9606 GN=HLA-DOA PE=1 SV=1
14	Q95HB9	1.05e-91	273	260	0.587	0.573	Q95HB9_HUMAN HLA class II histocompatibility antigen DP alpha chain OS=Homo sapiens OX=9606 GN=HLA-DPA1 PE=1 SV=1
15	P20036	1.60e-89	267	260	0.583	0.569	DPA1_HUMAN HLA class II histocompatibility antigen, DP alpha 1 chain OS=Homo sapiens OX=9606 GN=HLA-DPA1 PE=1 SV=1
16	X5CKE2	1.60e-89	267	260	0.583	0.569	X5CKE2_HUMAN HLA class II histocompatibility antigen DP alpha chain OS=Homo sapiens OX=9606 GN=HLA-DPA1 PE=3 SV=1
17	P14439	1.79e-80	244	255	0.496	0.494	HA23_MOUSE H-2 class II histocompatibility antigen, E-U alpha chain OS=Mus musculus OX=10090 GN=H2-Ea PE=2 SV=2
18	P01903	3.83e-80	243	254	0.531	0.531	DRA_HUMAN HLA class II histocompatibility antigen, DR alpha chain OS=Homo sapiens OX=9606 GN=HLA-DRA PE=1 SV=2
19	Q31150	1.78e-78	239	250	0.500	0.508	Q31150_MOUSE MHC class II alpha chain OS=Mus musculus OX=10090 GN=H2-Oa PE=2 SV=1
20	B2RST7	1.22e-77	236	250	0.496	0.504	B2RST7_MOUSE Histocompatibility 2, O region alpha locus OS=Mus musculus OX=10090 GN=H2-Oa PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	3e-22	90.1	Immunoglobulin C1-set domain
2	PF08205 C2-set_2	1.5	20.2	CD80-like C2-set immunoglobulin domain
3	PF08356 EF_assoc_2	23	16.4	EF hand associated
4	PF13927 Ig_3	0.13	24.1	Immunoglobulin domain
5	PF00993 MHC_II_alpha	1.9e-27	106.1	Class II histocompatibility antigen, alpha domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008957594.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008958919.1	0.985	HLA class II histocompatibility antigen, DQ beta 2 chain isoform X1
2	9597.XP_003829068.1	0.975	CD74 molecule
3	9597.XP_008957596.1	0.975	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 1 base in 1 codon
4	9597.XP_008958923.1	0.975	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 17 mRNAs, 148 ESTs, 498 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 10 samples with support for all annotated introns
5	9597.XP_003808649.1	0.923	HLA class II histocompatibility antigen, DM beta chain
6	9597.XP_003829806.1	0.915	HLA class II histocompatibility antigen, DRB1-4 beta chain
7	9597.XP_008953375.1	0.915	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: deleted 1 base in 1 codon
8	9597.XP_008971926.1	0.909	CD4 molecule
9	9597.XP_008958910.1	0.877	HLA class II histocompatibility antigen, DM alpha chain isoform X1
10	9597.XP_003808643.1	0.855	HLA class II histocompatibility antigen, DP beta 1 chain
11	9597.XP_003829807.1	0.841	HLA class II histocompatibility antigen, DR alpha chain
12	9597.XP_003824647.1	0.791	CD247 molecule
13	9597.XP_003813923.1	0.790	Neuropeptides that play a significant role in the regulation of food intake and sleep-wakefulness, possibly by coordinating the complex behavioral and physiologic responses of these complementary homeostatic functions. A broader role in the homeostatic regulation of energy metabolism, autonomic function, hormonal balance and the regulation of body fluids, is also suggested.
14	9597.XP_008958918.1	0.786	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 mRNAs, 8 ESTs, 8 Proteins, and 82% coverage of the annotated genomic feature by RNAseq alignments
15	9597.XP_008958927.1	0.754	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: deleted 2 bases in 1 codon
16	9597.XP_003808645.1	0.746	Belongs to the MHC class II family.
17	9597.XP_008958907.1	0.736	HLA class II histocompatibility antigen, DO alpha chain isoform X1
18	9597.XP_003820618.1	0.643	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 mRNAs, 12 Proteins
19	9597.XP_003820629.2	0.643	Uncharacterized protein LOC100982662
20	9597.XP_008972273.1	0.643	Uncharacterized protein LOC100983000

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0038023	0.951	signaling receptor activity
GO:0004888	0.872	transmembrane signaling receptor activity
GO:0042605	0.855	peptide antigen binding
GO:0140375	0.750	immune receptor activity
GO:0032395	0.639	MHC class II receptor activity
GO:0044877	0.394	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0002682	0.993	regulation of immune system process
GO:0050794	0.987	regulation of cellular process
GO:0030155	0.981	regulation of cell adhesion
GO:0048522	0.977	positive regulation of cellular process
GO:0050863	0.969	regulation of T cell activation
GO:0051240	0.966	positive regulation of multicellular organismal process
GO:0002376	0.965	immune system process
GO:0002684	0.941	positive regulation of immune system process
GO:0002696	0.927	positive regulation of leukocyte activation
GO:0019882	0.902	antigen processing and presentation
GO:0022407	0.889	regulation of cell-cell adhesion
GO:0048002	0.872	antigen processing and presentation of peptide antigen
GO:0002478	0.857	antigen processing and presentation of exogenous peptide antigen
GO:0002495	0.848	antigen processing and presentation of peptide antigen via MHC class II
GO:0009987	0.820	cellular process
GO:0019886	0.817	antigen processing and presentation of exogenous peptide antigen via MHC class II
GO:0048583	0.784	regulation of response to stimulus
GO:1903037	0.770	regulation of leukocyte cell-cell adhesion
GO:0045785	0.766	positive regulation of cell adhesion
GO:0050870	0.755	positive regulation of T cell activation
GO:0050776	0.753	regulation of immune response
GO:0050896	0.718	response to stimulus
GO:0006955	0.662	immune response
GO:0048584	0.623	positive regulation of response to stimulus
GO:2000026	0.605	regulation of multicellular organismal development
GO:0045595	0.548	regulation of cell differentiation
GO:1903706	0.533	regulation of hemopoiesis
GO:0045619	0.515	regulation of lymphocyte differentiation
GO:0045580	0.499	regulation of T cell differentiation
GO:0051716	0.475	cellular response to stimulus
GO:0050778	0.475	positive regulation of immune response
GO:0048519	0.397	negative regulation of biological process
GO:0009605	0.391	response to external stimulus
GO:1902107	0.390	positive regulation of leukocyte differentiation
GO:0044419	0.379	biological process involved in interspecies interaction between organisms
GO:0045582	0.340	positive regulation of T cell differentiation
GO:0007165	0.334	signal transduction
GO:0006950	0.325	response to stress
GO:0051707	0.309	response to other organism

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.998	endomembrane system
GO:0098552	0.998	side of membrane
GO:0005886	0.998	plasma membrane
GO:0031410	0.998	cytoplasmic vesicle
GO:0005764	0.998	lysosome
GO:0031090	0.997	organelle membrane
GO:0005794	0.988	Golgi apparatus
GO:0031984	0.986	organelle subcompartment
GO:0005765	0.986	lysosomal membrane
GO:0030135	0.985	coated vesicle
GO:0030133	0.985	transport vesicle
GO:0032991	0.984	protein-containing complex
GO:0030134	0.983	COPII-coated ER to Golgi transport vesicle
GO:0030662	0.983	coated vesicle membrane
GO:0030658	0.983	transport vesicle membrane
GO:0005802	0.975	trans-Golgi network
GO:0045334	0.974	clathrin-coated endocytic vesicle
GO:0032588	0.973	trans-Golgi network membrane
GO:0030666	0.973	endocytic vesicle membrane
GO:0098576	0.965	lumenal side of membrane
GO:0012507	0.962	ER to Golgi transport vesicle membrane
GO:0030669	0.962	clathrin-coated endocytic vesicle membrane
GO:0098553	0.961	lumenal side of endoplasmic reticulum membrane
GO:0000139	0.942	Golgi membrane
GO:0005768	0.885	endosome
GO:0098797	0.866	plasma membrane protein complex
GO:0010008	0.811	endosome membrane
GO:0005576	0.736	extracellular region
GO:0042611	0.735	MHC protein complex
GO:0009986	0.733	cell surface
GO:0042613	0.696	MHC class II protein complex
GO:0005615	0.449	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]