StarFunc result for job id P01911

User Input

>input (266 residues)
MVCLKLPGGSCMTALTVTLMVLSSPLALSGDTRPRFLWQPKRECHFFNGTERVRFLDRYF
YNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTV
QRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNG
DWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLL
FLGAGLFIYFRNQKGHSGLQPTGFLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P79483	0.954	0.954	6.335E-45	266	0.891	0.891	P79483.pdb.gz	DRB3_HUMAN HLA class II histocompatibility antigen, DR beta 3 chain OS=Homo sapiens OX=9606 GN=HLA-DRB3 PE=1 SV=1
2	AFDB:A0A0G4PYZ0	0.849	0.849	1.600E-43	266	0.910	0.910	A0A0G4PYZ0.pdb.gz	A0A0G4PYZ0_HUMAN MHC class II antigen OS=Homo sapiens OX=9606 GN=HLA-DRB1 PE=1 SV=1
3	AFDB:Q30154	0.809	0.809	1.105E-41	266	0.887	0.887	Q30154.pdb.gz	DRB5_HUMAN HLA class II histocompatibility antigen, DR beta 5 chain OS=Homo sapiens OX=9606 GN=HLA-DRB5 PE=1 SV=1
4	AFDB:P13762	0.795	0.795	4.616E-41	266	0.876	0.876	P13762.pdb.gz	DRB4_HUMAN HLA class II histocompatibility antigen, DR beta 4 chain OS=Homo sapiens OX=9606 GN=HLA-DRB4 PE=1 SV=2
5	AFDB:P04230	0.745	0.750	2.794E-38	264	0.741	0.746	P04230.pdb.gz	HB21_MOUSE H-2 class II histocompatibility antigen, E-B beta chain OS=Mus musculus OX=10090 GN=H2-Eb1 PE=1 SV=1
6	AFDB:P18211	0.710	0.714	1.367E-37	264	0.718	0.723	P18211.pdb.gz	HB2D_RAT Rano class II histocompatibility antigen, D-1 beta chain OS=Rattus norvegicus OX=10116 GN=RT1-Db1 PE=2 SV=1
7	AFDB:P05538	0.756	0.751	2.724E-33	268	0.632	0.627	P05538.pdb.gz	DQB2_HUMAN HLA class II histocompatibility antigen, DQ beta 2 chain OS=Homo sapiens OX=9606 GN=HLA-DQB2 PE=1 SV=2
8	AFDB:P29826	0.766	0.774	4.273E-32	263	0.598	0.605	P29826.pdb.gz	HB2B_RAT Rano class II histocompatibility antigen, B-1 beta chain OS=Rattus norvegicus OX=10116 GN=RT1-Bb PE=1 SV=1
9	AFDB:A0A1C3PI11	0.723	0.744	1.984E-31	258	0.605	0.624	A0A1C3PI11.pdb.gz	A0A1C3PI11_HUMAN HLA class II histocompatibility antigen DP beta chain OS=Homo sapiens OX=9606 GN=HLA-DPB1 PE=1 SV=1
10	AFDB:P01921	0.749	0.752	9.209E-31	265	0.613	0.615	P01921.pdb.gz	HB2D_MOUSE H-2 class II histocompatibility antigen, A-D beta chain OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1
11	PDB:6cplA	0.385	0.555	1.134E-13	180	0.169	0.250	6cplA.pdb.gz	CD4+T cell-mediated HLA class II cross-restriction in HIV controllers.
12	PDB:3es6A	0.513	0.496	1.164E-12	277	0.158	0.152	3es6A.pdb.gz	Crystal structure of the novel complex formed between zinc alpha2-glycoprotein (ZAG) and prolactin-inducible protein (PIP) from human seminal plasma
13	PDB:5j6hA	0.472	0.459	3.019E-12	275	0.192	0.185	5j6hA.pdb.gz	Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
14	PDB:6e1iA	0.439	0.331	1.105E-10	389	0.184	0.126	6e1iA.pdb.gz
15	PDB:6fgbA	0.510	0.511	1.600E-10	265	0.162	0.162	6fgbA.pdb.gz
16	PDB:6d7gA	0.441	0.332	2.717E-10	386	0.169	0.117	6d7gA.pdb.gz
17	PDB:1cd1A	0.533	0.521	4.614E-10	273	0.154	0.150	1cd1A.pdb.gz
18	PDB:3s6cA	0.501	0.374	6.338E-10	372	0.162	0.116	3s6cA.pdb.gz
19	PDB:6mp0A	0.444	0.329	1.021E-9	388	0.169	0.116	6mp0A.pdb.gz
20	PDB:2qriA	0.501	0.356	1.402E-9	398	0.177	0.118	2qriA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P01911	0.0	552	266	1.000	1.000	DRB1_HUMAN HLA class II histocompatibility antigen, DRB1 beta chain OS=Homo sapiens OX=9606 GN=HLA-DRB1 PE=1 SV=2
2	A0A0G4PYZ0	7.05e-171	474	266	0.910	0.910	A0A0G4PYZ0_HUMAN MHC class II antigen OS=Homo sapiens OX=9606 GN=HLA-DRB1 PE=1 SV=1
3	Q30154	2.44e-167	465	266	0.887	0.887	DRB5_HUMAN HLA class II histocompatibility antigen, DR beta 5 chain OS=Homo sapiens OX=9606 GN=HLA-DRB5 PE=1 SV=1
4	P79483	6.39e-167	464	266	0.891	0.891	DRB3_HUMAN HLA class II histocompatibility antigen, DR beta 3 chain OS=Homo sapiens OX=9606 GN=HLA-DRB3 PE=1 SV=1
5	P13762	6.60e-166	461	266	0.876	0.876	DRB4_HUMAN HLA class II histocompatibility antigen, DR beta 4 chain OS=Homo sapiens OX=9606 GN=HLA-DRB4 PE=1 SV=2
6	P18468	9.31e-150	420	264	0.748	0.754	HB2I_MOUSE H-2 class II histocompatibility antigen, I-A beta chain OS=Mus musculus OX=10090 GN=H2-Eb1 PE=1 SV=1
7	P18469	2.84e-142	401	264	0.752	0.758	HB2J_MOUSE H-2 class II histocompatibility antigen, I-E beta chain OS=Mus musculus OX=10090 GN=H2-Eb1 PE=1 SV=1
8	P04230	4.28e-138	391	264	0.741	0.746	HB21_MOUSE H-2 class II histocompatibility antigen, E-B beta chain OS=Mus musculus OX=10090 GN=H2-Eb1 PE=1 SV=1
9	P18211	1.33e-132	377	264	0.718	0.723	HB2D_RAT Rano class II histocompatibility antigen, D-1 beta chain OS=Rattus norvegicus OX=10116 GN=RT1-Db1 PE=2 SV=1
10	P04231	4.66e-130	369	232	0.695	0.797	HB23_MOUSE H-2 class II histocompatibility antigen, E-S beta chain (Fragment) OS=Mus musculus OX=10090 GN=H2-Eb1 PE=1 SV=1
11	P06342	4.20e-118	340	265	0.628	0.630	HB2Q_MOUSE H-2 class II histocompatibility antigen, A-Q beta chain OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1
12	A0A1C3PI11	2.78e-117	338	258	0.605	0.624	A0A1C3PI11_HUMAN HLA class II histocompatibility antigen DP beta chain OS=Homo sapiens OX=9606 GN=HLA-DPB1 PE=1 SV=1
13	Q30059	1.66e-116	336	258	0.605	0.624	Q30059_HUMAN MHC class II lymphocyte antigen beta chain OS=Homo sapiens OX=9606 GN=HLA-DPB1 PE=2 SV=1
14	Q95HA4	1.91e-116	336	257	0.602	0.623	Q95HA4_HUMAN HLA-DPB1 protein OS=Homo sapiens OX=9606 PE=1 SV=1
15	P14483	4.79e-116	335	265	0.620	0.623	HB2A_MOUSE H-2 class II histocompatibility antigen, A beta chain OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1
16	P04440	5.40e-116	335	258	0.605	0.624	DPB1_HUMAN HLA class II histocompatibility antigen, DP beta 1 chain OS=Homo sapiens OX=9606 GN=HLA-DPB1 PE=1 SV=1
17	P01921	6.03e-116	335	265	0.617	0.619	HB2D_MOUSE H-2 class II histocompatibility antigen, A-D beta chain OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1
18	P06345	2.36e-115	333	263	0.624	0.631	HB2S_MOUSE H-2 class II histocompatibility antigen, A-S beta chain OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1
19	P06346	4.11e-112	325	252	0.605	0.639	HB2F_MOUSE H-2 class II histocompatibility antigen, A-F beta chain (Fragment) OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1
20	P01920	3.55e-109	317	261	0.598	0.609	DQB1_HUMAN HLA class II histocompatibility antigen, DQ beta 1 chain OS=Homo sapiens OX=9606 GN=HLA-DQB1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	3.1e-22	90.0	Immunoglobulin C1-set domain
2	PF08205 C2-set_2	3.3e+02	12.7	CD80-like C2-set immunoglobulin domain
3	PF02656 DUF202	3e+02	13.3	Domain of unknown function (DUF202)
4	PF00047 ig	0.44	22.1	Immunoglobulin domain
5	PF02124 Marek_A	2.1e+02	13.7	Marek's disease glycoprotein A
6	PF00969 MHC_II_beta	3.9e-35	131.1	Class II histocompatibility antigen, beta domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000353099

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378786	0.999	HLA class II histocompatibility antigen, DR alpha chain
2	9606.ENSP00000363976	0.998	HLA class II histocompatibility antigen, DM alpha chain
3	9606.ENSP00000009530	0.994	HLA class II histocompatibility antigen gamma chain
4	9606.ENSP00000352833	0.989	Tyrosine-protein phosphatase non-receptor type 22
5	9606.ENSP00000398890	0.989	HLA class II histocompatibility antigen, DM beta chain
6	9606.ENSP00000393566	0.977	HLA class II histocompatibility antigen, DP alpha 1 chain
7	9606.ENSP00000011653	0.975	T-cell surface glycoprotein CD4
8	9606.ENSP00000390613	0.967	Butyrophilin-like protein 2
9	9606.ENSP00000332049	0.956	T-lymphocyte activation antigen CD86
10	9606.ENSP00000411355	0.950	Receptor-type tyrosine-protein phosphatase C
11	9606.ENSP00000229829	0.945	HLA class II histocompatibility antigen, DO alpha chain
12	9606.ENSP00000264246	0.944	T-lymphocyte activation antigen CD80
13	9606.ENSP00000364114	0.944	HLA class II histocompatibility antigen, DR beta 5 chain
14	9606.ENSP00000399168	0.941	HLA class I histocompatibility antigen, B-7 alpha chain
15	9606.ENSP00000365402	0.940	HLA class I histocompatibility antigen, Cw-7 alpha chain
16	9606.ENSP00000354782	0.939	T-cell surface glycoprotein CD3 zeta chain
17	9606.ENSP00000356429	0.939	Regulator of G-protein signaling 1
18	9606.ENSP00000357981	0.939	Cathepsin S
19	9606.ENSP00000324890	0.938	T-cell-specific surface glycoprotein CD28
20	9606.ENSP00000379873	0.938	HLA class I histocompatibility antigen, A-3 alpha chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003823	0.843	antigen binding
GO:0044877	0.551	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0002504	0.995	antigen processing and presentation of peptide or polysaccharide antigen via MHC class II
GO:0019884	0.993	antigen processing and presentation of exogenous antigen
GO:0050896	0.991	response to stimulus
GO:0048002	0.982	antigen processing and presentation of peptide antigen
GO:0002495	0.957	antigen processing and presentation of peptide antigen via MHC class II
GO:0019886	0.954	antigen processing and presentation of exogenous peptide antigen via MHC class II
GO:0050789	0.916	regulation of biological process
GO:0009987	0.911	cellular process
GO:0050794	0.905	regulation of cellular process
GO:0048518	0.788	positive regulation of biological process
GO:0006955	0.761	immune response
GO:0051716	0.706	cellular response to stimulus
GO:0048522	0.696	positive regulation of cellular process
GO:0002682	0.530	regulation of immune system process
GO:0048583	0.503	regulation of response to stimulus
GO:0007154	0.499	cell communication
GO:0002684	0.485	positive regulation of immune system process
GO:0007165	0.477	signal transduction
GO:0048584	0.467	positive regulation of response to stimulus
GO:0019222	0.457	regulation of metabolic process
GO:0051239	0.438	regulation of multicellular organismal process
GO:0060255	0.436	regulation of macromolecule metabolic process
GO:0050778	0.427	positive regulation of immune response
GO:0048519	0.395	negative regulation of biological process
GO:0010468	0.373	regulation of gene expression
GO:0009893	0.372	positive regulation of metabolic process
GO:0048523	0.368	negative regulation of cellular process
GO:0050865	0.321	regulation of cell activation
GO:0007166	0.321	cell surface receptor signaling pathway
GO:0010604	0.315	positive regulation of macromolecule metabolic process
GO:0002764	0.315	immune response-regulating signaling pathway
GO:0002694	0.309	regulation of leukocyte activation
GO:0002757	0.306	immune response-activating signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0031410	0.999	cytoplasmic vesicle
GO:0098588	0.998	bounding membrane of organelle
GO:0005794	0.995	Golgi apparatus
GO:0000323	0.995	lytic vacuole
GO:0098796	0.994	membrane protein complex
GO:0005764	0.992	lysosome
GO:0030659	0.989	cytoplasmic vesicle membrane
GO:0005765	0.983	lysosomal membrane
GO:0030666	0.983	endocytic vesicle membrane
GO:0005789	0.980	endoplasmic reticulum membrane
GO:0030662	0.980	coated vesicle membrane
GO:0000139	0.978	Golgi membrane
GO:0005768	0.977	endosome
GO:0030134	0.975	COPII-coated ER to Golgi transport vesicle
GO:0045334	0.975	clathrin-coated endocytic vesicle
GO:0012507	0.974	ER to Golgi transport vesicle membrane
GO:0030669	0.972	clathrin-coated endocytic vesicle membrane
GO:0005576	0.969	extracellular region
GO:0032588	0.968	trans-Golgi network membrane
GO:0098553	0.967	lumenal side of endoplasmic reticulum membrane
GO:0098797	0.961	plasma membrane protein complex
GO:0031902	0.933	late endosome membrane
GO:0042613	0.926	MHC class II protein complex
GO:0070062	0.921	extracellular exosome
GO:0009986	0.528	cell surface
GO:0009897	0.334	external side of plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]