StarFunc result for job id P01920

User Input

>input (261 residues)
MSWKKALRIPGGLRAATVTLMLAMLSTPVAEGRDSPEDFVYQFKAMCYFTNGTERVRYVT
RYIYNREEYARFDSDVEVYRAVTPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQLELR
TTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLI
RNGDWTFQILVMLEMTPQHGDVYTCHVEHPSLQNPITVEWRAQSESAQSKMLSGIGGFVL
GLIFLGLGLIIHHRSQKGLLH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P01920	1.000	1.000	3.271E-48	261	1.000	1.000	P01920.pdb.gz	DQB1_HUMAN HLA class II histocompatibility antigen, DQ beta 1 chain OS=Homo sapiens OX=9606 GN=HLA-DQB1 PE=1 SV=2
2	AFDB:P05538	0.776	0.757	3.804E-37	268	0.805	0.784	P05538.pdb.gz	DQB2_HUMAN HLA class II histocompatibility antigen, DQ beta 2 chain OS=Homo sapiens OX=9606 GN=HLA-DQB2 PE=1 SV=2
3	AFDB:P29826	0.726	0.721	1.786E-35	263	0.720	0.715	P29826.pdb.gz	HB2B_RAT Rano class II histocompatibility antigen, B-1 beta chain OS=Rattus norvegicus OX=10116 GN=RT1-Bb PE=1 SV=1
4	AFDB:P01921	0.706	0.697	4.739E-35	265	0.716	0.706	P01921.pdb.gz	HB2D_MOUSE H-2 class II histocompatibility antigen, A-D beta chain OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1
5	AFDB:Q30154	0.799	0.785	1.940E-34	266	0.628	0.617	Q30154.pdb.gz	DRB5_HUMAN HLA class II histocompatibility antigen, DR beta 5 chain OS=Homo sapiens OX=9606 GN=HLA-DRB5 PE=1 SV=1
6	AFDB:P13762	0.814	0.799	5.147E-34	266	0.613	0.602	P13762.pdb.gz	DRB4_HUMAN HLA class II histocompatibility antigen, DR beta 4 chain OS=Homo sapiens OX=9606 GN=HLA-DRB4 PE=1 SV=2
7	AFDB:A0A1C3PI11	0.780	0.788	3.826E-33	258	0.605	0.612	A0A1C3PI11.pdb.gz	A0A1C3PI11_HUMAN HLA class II histocompatibility antigen DP beta chain OS=Homo sapiens OX=9606 GN=HLA-DPB1 PE=1 SV=1
8	AFDB:P04230	0.736	0.729	4.039E-33	264	0.613	0.606	P04230.pdb.gz	HB21_MOUSE H-2 class II histocompatibility antigen, E-B beta chain OS=Mus musculus OX=10090 GN=H2-Eb1 PE=1 SV=1
9	AFDB:P18211	0.697	0.691	2.054E-32	264	0.575	0.568	P18211.pdb.gz	HB2D_RAT Rano class II histocompatibility antigen, D-1 beta chain OS=Rattus norvegicus OX=10116 GN=RT1-Db1 PE=2 SV=1
10	AFDB:A0A0G4PYZ0	0.770	0.758	3.345E-32	266	0.625	0.613	A0A0G4PYZ0.pdb.gz	A0A0G4PYZ0_HUMAN MHC class II antigen OS=Homo sapiens OX=9606 GN=HLA-DRB1 PE=1 SV=1
11	PDB:3es6A	0.522	0.496	9.964E-14	277	0.203	0.191	3es6A.pdb.gz	Crystal structure of the novel complex formed between zinc alpha2-glycoprotein (ZAG) and prolactin-inducible protein (PIP) from human seminal plasma
12	PDB:5j6hA	0.460	0.442	1.419E-12	275	0.184	0.175	5j6hA.pdb.gz	Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
13	PDB:6cplA	0.357	0.503	3.032E-12	180	0.165	0.239	6cplA.pdb.gz	CD4+T cell-mediated HLA class II cross-restriction in HIV controllers.
14	PDB:6fgbA	0.493	0.487	2.651E-11	265	0.192	0.189	6fgbA.pdb.gz
15	PDB:6d7gA	0.410	0.303	3.875E-11	386	0.188	0.127	6d7gA.pdb.gz
16	PDB:6e1iA	0.427	0.317	1.675E-10	389	0.192	0.129	6e1iA.pdb.gz
17	PDB:1cd1A	0.531	0.511	2.448E-10	273	0.184	0.176	1cd1A.pdb.gz
18	PDB:2qriA	0.467	0.330	2.728E-10	398	0.195	0.128	2qriA.pdb.gz
19	PDB:6mp0A	0.420	0.313	2.728E-10	388	0.184	0.124	6mp0A.pdb.gz
20	PDB:3ov6A	0.523	0.382	2.659E-9	376	0.180	0.125	3ov6A.pdb.gz	The 2.5 A structure of CD1c in complex with a mycobacterial lipid reveals an open groove ideally suited for diverse antigen presentation

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P01920	0.0	547	261	1.000	1.000	DQB1_HUMAN HLA class II histocompatibility antigen, DQ beta 1 chain OS=Homo sapiens OX=9606 GN=HLA-DQB1 PE=1 SV=2
2	P05538	6.80e-145	408	268	0.808	0.787	DQB2_HUMAN HLA class II histocompatibility antigen, DQ beta 2 chain OS=Homo sapiens OX=9606 GN=HLA-DQB2 PE=1 SV=2
3	P14483	8.08e-137	387	265	0.732	0.721	HB2A_MOUSE H-2 class II histocompatibility antigen, A beta chain OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1
4	P29826	2.15e-136	386	263	0.720	0.715	HB2B_RAT Rano class II histocompatibility antigen, B-1 beta chain OS=Rattus norvegicus OX=10116 GN=RT1-Bb PE=1 SV=1
5	P01921	3.54e-135	383	265	0.716	0.706	HB2D_MOUSE H-2 class II histocompatibility antigen, A-D beta chain OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1
6	P06342	5.60e-135	383	265	0.716	0.706	HB2Q_MOUSE H-2 class II histocompatibility antigen, A-Q beta chain OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1
7	P06345	5.97e-132	375	263	0.713	0.707	HB2S_MOUSE H-2 class II histocompatibility antigen, A-S beta chain OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1
8	P06343	1.93e-128	366	263	0.686	0.681	HB2K_MOUSE H-2 class II histocompatibility antigen, A-K beta chain OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1
9	P06346	1.47e-127	363	252	0.697	0.722	HB2F_MOUSE H-2 class II histocompatibility antigen, A-F beta chain (Fragment) OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1
10	Q30059	5.98e-118	339	258	0.617	0.624	Q30059_HUMAN MHC class II lymphocyte antigen beta chain OS=Homo sapiens OX=9606 GN=HLA-DPB1 PE=2 SV=1
11	Q95HA4	6.28e-117	337	257	0.602	0.611	Q95HA4_HUMAN HLA-DPB1 protein OS=Homo sapiens OX=9606 PE=1 SV=1
12	A0A1C3PI11	7.17e-117	337	258	0.602	0.609	A0A1C3PI11_HUMAN HLA class II histocompatibility antigen DP beta chain OS=Homo sapiens OX=9606 GN=HLA-DPB1 PE=1 SV=1
13	P04440	2.61e-116	335	258	0.605	0.612	DPB1_HUMAN HLA class II histocompatibility antigen, DP beta 1 chain OS=Homo sapiens OX=9606 GN=HLA-DPB1 PE=1 SV=1
14	P18468	3.30e-113	328	264	0.598	0.591	HB2I_MOUSE H-2 class II histocompatibility antigen, I-A beta chain OS=Mus musculus OX=10090 GN=H2-Eb1 PE=1 SV=1
15	Q30154	2.79e-110	320	266	0.628	0.617	DRB5_HUMAN HLA class II histocompatibility antigen, DR beta 5 chain OS=Homo sapiens OX=9606 GN=HLA-DRB5 PE=1 SV=1
16	P18469	6.96e-110	319	264	0.617	0.610	HB2J_MOUSE H-2 class II histocompatibility antigen, I-E beta chain OS=Mus musculus OX=10090 GN=H2-Eb1 PE=1 SV=1
17	P13762	8.98e-110	319	266	0.613	0.602	DRB4_HUMAN HLA class II histocompatibility antigen, DR beta 4 chain OS=Homo sapiens OX=9606 GN=HLA-DRB4 PE=1 SV=2
18	A0A0G4PYZ0	1.53e-109	318	266	0.625	0.613	A0A0G4PYZ0_HUMAN MHC class II antigen OS=Homo sapiens OX=9606 GN=HLA-DRB1 PE=1 SV=1
19	P01911	2.51e-109	318	266	0.609	0.598	DRB1_HUMAN HLA class II histocompatibility antigen, DRB1 beta chain OS=Homo sapiens OX=9606 GN=HLA-DRB1 PE=1 SV=2
20	P04230	1.27e-106	311	264	0.605	0.598	HB21_MOUSE H-2 class II histocompatibility antigen, E-B beta chain OS=Mus musculus OX=10090 GN=H2-Eb1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	5.4e-25	98.9	Immunoglobulin C1-set domain
2	PF08205 C2-set_2	0.27	22.6	CD80-like C2-set immunoglobulin domain
3	PF00047 ig	0.62	21.6	Immunoglobulin domain
4	PF13895 Ig_2	16	17.2	Immunoglobulin domain
5	PF13927 Ig_3	0.00045	32.0	Immunoglobulin domain
6	PF02124 Marek_A	53	15.6	Marek's disease glycoprotein A
7	PF00129 MHC_I	9.4	17.3	Class I Histocompatibility antigen, domains alpha 1 and 2
8	PF00969 MHC_II_beta	2e-32	122.5	Class II histocompatibility antigen, beta domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000030768

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000030767	0.996	Major histocompatibility complex, class II, DQ alpha 1
2	9598.ENSPTRP00000047911	0.953	Uncharacterized protein
3	9598.ENSPTRP00000054833	0.932	Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class II molecule:peptide complex. The antigens presented by class II peptides are derived from extracellular proteins while class I peptides are derived from cytosolic proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class II presented by antigen presenting cells (APCs). In turn, recruits the Src kinase LCK to the vicinity of the TCR [...]
4	9598.ENSPTRP00000055403	0.929	Major histocompatibility complex, class II, DQ alpha 2
5	9598.ENSPTRP00000030785	0.908	Major histocompatibility complex, class II, DP alpha 1
6	9598.ENSPTRP00000030766	0.902	Pan troglodytes major histocompatibility complex, class II, DR alpha (PATR-DRA), mRNA
7	9598.ENSPTRP00000030784	0.856	Major histocompatibility complex, class II, DO alpha
8	9598.ENSPTRP00000030778	0.852	Uncharacterized protein
9	9598.ENSPTRP00000005606	0.839	Insulin
10	9598.ENSPTRP00000030781	0.824	Major histocompatibility complex, class II, DM alpha
11	9598.ENSPTRP00000044167	0.804	Uncharacterized protein
12	9598.ENSPTRP00000003034	0.791	Uncharacterized protein
13	9598.ENSPTRP00000030772	0.766	Important modulator in the HLA class II restricted antigen presentation pathway by interaction with the HLA-DM molecule in B- cells. Modifies peptide exchange activity of HLA-DM
14	9598.ENSPTRP00000054452	0.744	Uncharacterized protein
15	9598.ENSPTRP00000030734	0.743	Major histocompatibility complex, class II, DR beta 5
16	9598.ENSPTRP00000001934	0.723	Protein tyrosine phosphatase, non-receptor type 22 (Lymphoid)
17	9598.ENSPTRP00000026356	0.723	Uncharacterized protein
18	9598.ENSPTRP00000026304	0.706	Uncharacterized protein
19	9598.ENSPTRP00000002144	0.672	Cathepsin S
20	9598.ENSPTRP00000060790	0.666	T cell receptor beta variable 7-4 (gene/pseudogene)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003823	0.827	antigen binding
GO:0042277	0.808	peptide binding
GO:0038023	0.750	signaling receptor activity
GO:0004888	0.735	transmembrane signaling receptor activity
GO:0042605	0.687	peptide antigen binding
GO:0140375	0.482	immune receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.991	response to stimulus
GO:0002376	0.987	immune system process
GO:0002495	0.967	antigen processing and presentation of peptide antigen via MHC class II
GO:0019886	0.963	antigen processing and presentation of exogenous peptide antigen via MHC class II
GO:0006955	0.958	immune response
GO:0050789	0.948	regulation of biological process
GO:0009987	0.922	cellular process
GO:0050794	0.916	regulation of cellular process
GO:0002682	0.891	regulation of immune system process
GO:0051716	0.884	cellular response to stimulus
GO:0007165	0.869	signal transduction
GO:0048518	0.856	positive regulation of biological process
GO:0048583	0.849	regulation of response to stimulus
GO:0007166	0.812	cell surface receptor signaling pathway
GO:0002684	0.759	positive regulation of immune system process
GO:0050778	0.748	positive regulation of immune response
GO:0002429	0.558	immune response-activating cell surface receptor signaling pathway
GO:0050851	0.545	antigen receptor-mediated signaling pathway
GO:0050852	0.495	T cell receptor signaling pathway
GO:0048522	0.450	positive regulation of cellular process
GO:0051251	0.377	positive regulation of lymphocyte activation
GO:0045785	0.356	positive regulation of cell adhesion
GO:0050863	0.352	regulation of T cell activation
GO:0042221	0.351	response to chemical
GO:0022407	0.349	regulation of cell-cell adhesion
GO:0002250	0.344	adaptive immune response
GO:1903037	0.344	regulation of leukocyte cell-cell adhesion
GO:0022409	0.335	positive regulation of cell-cell adhesion
GO:0010033	0.310	response to organic substance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0031410	0.999	cytoplasmic vesicle
GO:0098552	0.998	side of membrane
GO:0098797	0.995	plasma membrane protein complex
GO:0098588	0.987	bounding membrane of organelle
GO:0005794	0.984	Golgi apparatus
GO:0030659	0.981	cytoplasmic vesicle membrane
GO:0005789	0.978	endoplasmic reticulum membrane
GO:0098576	0.976	lumenal side of membrane
GO:0005765	0.976	lysosomal membrane
GO:0030666	0.973	endocytic vesicle membrane
GO:0098553	0.973	lumenal side of endoplasmic reticulum membrane
GO:0042613	0.972	MHC class II protein complex
GO:0005768	0.968	endosome
GO:0030134	0.966	COPII-coated ER to Golgi transport vesicle
GO:0030662	0.966	coated vesicle membrane
GO:0030658	0.965	transport vesicle membrane
GO:0032588	0.963	trans-Golgi network membrane
GO:0012507	0.963	ER to Golgi transport vesicle membrane
GO:0030665	0.962	clathrin-coated vesicle membrane
GO:0045334	0.956	clathrin-coated endocytic vesicle
GO:0030669	0.948	clathrin-coated endocytic vesicle membrane
GO:0000139	0.922	Golgi membrane
GO:0009986	0.864	cell surface
GO:0005770	0.751	late endosome
GO:0009897	0.651	external side of plasma membrane
GO:0005576	0.467	extracellular region
GO:0005771	0.377	multivesicular body
GO:0005615	0.350	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]